Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7953
Gene name
Locationscaffold_825:3790..6486
Strand-
Gene length (bp)2696
Transcript length (bp)2568
Coding sequence length (bp)2565
Protein length (aa) 855

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain 1.9E-154 497 846
PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain 8.9E-103 166 489

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZ24|ENG1_ARTBC Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01444 PE=1 SV=1 108 850 0.0E+00
sp|Q09850|ENG2_SCHPO Putative endo-1,3(4)-beta-glucanase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eng2 PE=3 SV=1 146 854 1.0E-158
sp|Q9UT45|ENG1_SCHPO Endo-1,3(4)-beta-glucanase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eng1 PE=3 SV=1 128 852 3.0E-146
sp|Q12168|ENG2_YEAST Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACF2 PE=1 SV=1 145 853 2.0E-142
sp|Q5AIR7|ENG1_CANAL Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ENG1 PE=1 SV=1 145 850 2.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZ24|ENG1_ARTBC Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01444 PE=1 SV=1 108 850 0.0E+00
sp|Q09850|ENG2_SCHPO Putative endo-1,3(4)-beta-glucanase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eng2 PE=3 SV=1 146 854 1.0E-158
sp|Q9UT45|ENG1_SCHPO Endo-1,3(4)-beta-glucanase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eng1 PE=3 SV=1 128 852 3.0E-146
sp|Q12168|ENG2_YEAST Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACF2 PE=1 SV=1 145 853 2.0E-142
sp|Q5AIR7|ENG1_CANAL Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ENG1 PE=1 SV=1 145 850 2.0E-136
sp|P53753|ENG1_YEAST Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSE4 PE=1 SV=1 156 854 1.0E-135
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7953
MDRCRLLWLVLLLTGGAQASAIRTNSSRAASQIASLLQEQLIFFNSDLWNRTLSSAGVELSQHRGGPVLNQVAEP
VLSGLRRQKIHTAQQAVSSTLTAEHLEATRAPFSNWTWRSSSAPPRSEDEELEQQAETGPNDYVMGEERDIFSKP
IDLKAPPDMIQRRQDHPVPRKGIKARGPLQTNKFYANFFLGDQLGPIYTFPYSLQWAGGKGRTGSHGMSISHVEA
HQQVFGGKERVKGASSFYINPIGIQSLVISATELSNKTTLTTDSLTPHSVRAHLSKDGQSPPSVSFPLVQGMACV
TAQFEGAKPVLQSGVTFKTVTRVTREPKKGVAKYNFVLADGTSWRVYGWHTKGDGLELTVANDGRAESKRPFTGL
LQVCKDPGTEGSEAALDDGAGVFAETVGLSGWASGREGRYRLRFERGGHKDGQLNMYALPHHVESFDDGTRKLVK
AKAQLQTPTKGVATLVCGEEWTLVEAEMAVDMGFAPWHPERGNADKLSPEAKRTIRAAAARELAQDMAAQSNVDS
MYFSGKALAKFAAAVWVVHRMVGDAELAQTGLRRLQAAFATFASNRQRFPLTYESAWGGVVSRATYDTGDGGVDF
GNSLYNDHHFHYGYHILAAAMIADLDEGWGKANADYVRTLVRDIANPSASDRLFPQWRCFDWYHGHSWAHGLYAA
MDGKNQESSSEDMMAAYALKMWGRVSADAELEARSNLQLSVLARSLRAYYLYEADNSVQPRRFIGNKVAGILFEN
KVDHTTFFDGSIEAIQGIHMIPILPPTAFVRRRRFVAEEWETYFSRGRIDEVASAWKSIIYASYATVDPAAAFKF
FSSTSFQPQWLDGGASLTWFMAYAAALGGL
Coding >Ophio5|7953
ATGGATCGGTGTCGTCTGTTATGGCTGGTCTTGTTGCTGACGGGCGGTGCCCAGGCGTCTGCCATCCGGACCAAT
AGCTCTCGAGCCGCCAGCCAGATTGCTTCGCTTTTGCAGGAGCAGCTCATTTTTTTCAATTCGGACCTGTGGAAC
CGAACGTTGTCGAGTGCAGGAGTCGAATTATCGCAGCACCGAGGAGGCCCCGTCTTGAACCAAGTTGCTGAACCA
GTCCTGAGCGGGCTTCGCCGGCAGAAGATCCACACGGCCCAACAGGCAGTGTCATCGACGCTCACGGCGGAGCAC
TTGGAAGCCACGAGGGCCCCGTTTTCTAACTGGACGTGGCGATCGTCGAGCGCACCGCCTAGATCCGAGGACGAG
GAGCTCGAGCAGCAGGCCGAGACCGGTCCCAACGACTACGTCATGGGAGAGGAACGCGACATCTTCTCGAAGCCC
ATCGATCTCAAGGCGCCGCCCGATATGATCCAGCGGCGGCAGGATCACCCAGTGCCGCGCAAGGGCATCAAGGCG
CGCGGGCCTCTGCAGACCAACAAGTTCTACGCCAACTTCTTCCTCGGCGACCAGCTGGGCCCCATCTACACGTTT
CCCTACTCGTTGCAGTGGGCCGGAGGCAAGGGGAGAACGGGCAGCCATGGCATGTCCATCAGCCACGTGGAGGCG
CACCAGCAGGTGTTTGGCGGCAAGGAACGCGTTAAGGGGGCGTCGTCGTTTTACATCAACCCGATCGGGATCCAG
TCGCTGGTCATCTCGGCGACGGAGCTCAGCAACAAGACGACACTGACGACGGACAGCCTGACGCCGCATTCGGTG
CGGGCGCACCTCAGCAAGGACGGTCAGTCGCCGCCCTCGGTTTCTTTCCCGCTGGTGCAGGGCATGGCGTGCGTG
ACGGCGCAGTTTGAGGGCGCGAAGCCGGTGTTGCAGTCGGGCGTCACGTTCAAGACGGTGACGCGGGTGACGCGC
GAGCCCAAGAAGGGCGTGGCCAAGTACAACTTTGTGCTGGCCGACGGCACGAGCTGGCGAGTGTACGGCTGGCAC
ACCAAGGGCGACGGACTGGAGCTGACGGTGGCCAACGACGGACGGGCCGAGTCGAAGCGACCCTTTACCGGGTTG
CTGCAAGTGTGCAAGGACCCCGGCACGGAGGGATCGGAAGCAGCGCTGGACGACGGCGCCGGCGTCTTCGCCGAG
ACGGTGGGGCTGTCGGGATGGGCGTCCGGACGAGAGGGCCGATATCGGCTCCGCTTCGAACGCGGCGGGCACAAG
GACGGACAGCTGAACATGTACGCGCTGCCTCACCACGTGGAGTCGTTTGACGATGGGACGCGAAAGCTGGTCAAG
GCCAAGGCGCAGCTACAGACGCCGACCAAGGGCGTGGCGACGCTGGTGTGCGGCGAGGAGTGGACGCTGGTAGAG
GCCGAGATGGCGGTGGACATGGGCTTCGCGCCGTGGCATCCGGAGCGAGGCAACGCCGACAAGCTGTCGCCCGAG
GCCAAGCGGACGATCCGGGCGGCGGCAGCGCGCGAGCTGGCGCAGGACATGGCGGCGCAATCCAACGTCGACTCC
ATGTACTTCAGCGGCAAGGCGCTGGCCAAGTTCGCGGCGGCGGTGTGGGTGGTGCATCGGATGGTGGGCGACGCC
GAGCTGGCTCAGACGGGGCTCAGGCGGCTCCAAGCGGCGTTTGCGACGTTCGCCAGCAACAGACAGCGCTTCCCG
TTGACGTACGAATCGGCCTGGGGCGGCGTGGTGTCGCGGGCGACGTACGACACGGGCGACGGCGGCGTCGACTTT
GGCAACTCGCTGTACAACGATCACCACTTCCACTACGGCTACCACATCCTGGCGGCGGCCATGATTGCCGACCTG
GATGAGGGCTGGGGCAAGGCCAACGCCGACTACGTCCGGACGCTGGTGCGCGACATTGCCAACCCGAGCGCGTCG
GACCGTCTCTTCCCCCAGTGGCGCTGCTTCGACTGGTATCACGGCCACAGCTGGGCTCACGGGCTGTACGCGGCC
ATGGACGGCAAGAACCAGGAATCGAGCTCGGAGGACATGATGGCGGCCTACGCCCTCAAGATGTGGGGGCGCGTC
TCGGCCGACGCCGAGTTGGAGGCTCGGTCGAACCTGCAGCTGTCGGTGCTGGCCCGCAGCCTTCGAGCCTATTAC
CTGTACGAGGCGGACAATTCGGTTCAGCCTCGACGCTTCATCGGCAACAAGGTGGCCGGCATCCTGTTTGAGAAC
AAGGTGGACCACACGACCTTTTTCGACGGCAGCATCGAGGCCATCCAGGGCATCCACATGATCCCCATCTTGCCG
CCCACGGCCTTTGTCCGCCGTCGACGCTTCGTGGCCGAGGAGTGGGAGACGTACTTTAGCCGAGGACGGATCGAC
GAGGTGGCCAGCGCCTGGAAGAGCATCATTTACGCCAGCTACGCCACCGTCGACCCGGCCGCTGCCTTTAAGTTT
TTCTCGTCGACATCCTTTCAGCCGCAGTGGTTGGATGGAGGCGCGTCGCTGACGTGGTTTATGGCGTATGCTGCC
GCACTTGGCGGGCTG
Transcript >Ophio5|7953
ATGGATCGGTGTCGTCTGTTATGGCTGGTCTTGTTGCTGACGGGCGGTGCCCAGGCGTCTGCCATCCGGACCAAT
AGCTCTCGAGCCGCCAGCCAGATTGCTTCGCTTTTGCAGGAGCAGCTCATTTTTTTCAATTCGGACCTGTGGAAC
CGAACGTTGTCGAGTGCAGGAGTCGAATTATCGCAGCACCGAGGAGGCCCCGTCTTGAACCAAGTTGCTGAACCA
GTCCTGAGCGGGCTTCGCCGGCAGAAGATCCACACGGCCCAACAGGCAGTGTCATCGACGCTCACGGCGGAGCAC
TTGGAAGCCACGAGGGCCCCGTTTTCTAACTGGACGTGGCGATCGTCGAGCGCACCGCCTAGATCCGAGGACGAG
GAGCTCGAGCAGCAGGCCGAGACCGGTCCCAACGACTACGTCATGGGAGAGGAACGCGACATCTTCTCGAAGCCC
ATCGATCTCAAGGCGCCGCCCGATATGATCCAGCGGCGGCAGGATCACCCAGTGCCGCGCAAGGGCATCAAGGCG
CGCGGGCCTCTGCAGACCAACAAGTTCTACGCCAACTTCTTCCTCGGCGACCAGCTGGGCCCCATCTACACGTTT
CCCTACTCGTTGCAGTGGGCCGGAGGCAAGGGGAGAACGGGCAGCCATGGCATGTCCATCAGCCACGTGGAGGCG
CACCAGCAGGTGTTTGGCGGCAAGGAACGCGTTAAGGGGGCGTCGTCGTTTTACATCAACCCGATCGGGATCCAG
TCGCTGGTCATCTCGGCGACGGAGCTCAGCAACAAGACGACACTGACGACGGACAGCCTGACGCCGCATTCGGTG
CGGGCGCACCTCAGCAAGGACGGTCAGTCGCCGCCCTCGGTTTCTTTCCCGCTGGTGCAGGGCATGGCGTGCGTG
ACGGCGCAGTTTGAGGGCGCGAAGCCGGTGTTGCAGTCGGGCGTCACGTTCAAGACGGTGACGCGGGTGACGCGC
GAGCCCAAGAAGGGCGTGGCCAAGTACAACTTTGTGCTGGCCGACGGCACGAGCTGGCGAGTGTACGGCTGGCAC
ACCAAGGGCGACGGACTGGAGCTGACGGTGGCCAACGACGGACGGGCCGAGTCGAAGCGACCCTTTACCGGGTTG
CTGCAAGTGTGCAAGGACCCCGGCACGGAGGGATCGGAAGCAGCGCTGGACGACGGCGCCGGCGTCTTCGCCGAG
ACGGTGGGGCTGTCGGGATGGGCGTCCGGACGAGAGGGCCGATATCGGCTCCGCTTCGAACGCGGCGGGCACAAG
GACGGACAGCTGAACATGTACGCGCTGCCTCACCACGTGGAGTCGTTTGACGATGGGACGCGAAAGCTGGTCAAG
GCCAAGGCGCAGCTACAGACGCCGACCAAGGGCGTGGCGACGCTGGTGTGCGGCGAGGAGTGGACGCTGGTAGAG
GCCGAGATGGCGGTGGACATGGGCTTCGCGCCGTGGCATCCGGAGCGAGGCAACGCCGACAAGCTGTCGCCCGAG
GCCAAGCGGACGATCCGGGCGGCGGCAGCGCGCGAGCTGGCGCAGGACATGGCGGCGCAATCCAACGTCGACTCC
ATGTACTTCAGCGGCAAGGCGCTGGCCAAGTTCGCGGCGGCGGTGTGGGTGGTGCATCGGATGGTGGGCGACGCC
GAGCTGGCTCAGACGGGGCTCAGGCGGCTCCAAGCGGCGTTTGCGACGTTCGCCAGCAACAGACAGCGCTTCCCG
TTGACGTACGAATCGGCCTGGGGCGGCGTGGTGTCGCGGGCGACGTACGACACGGGCGACGGCGGCGTCGACTTT
GGCAACTCGCTGTACAACGATCACCACTTCCACTACGGCTACCACATCCTGGCGGCGGCCATGATTGCCGACCTG
GATGAGGGCTGGGGCAAGGCCAACGCCGACTACGTCCGGACGCTGGTGCGCGACATTGCCAACCCGAGCGCGTCG
GACCGTCTCTTCCCCCAGTGGCGCTGCTTCGACTGGTATCACGGCCACAGCTGGGCTCACGGGCTGTACGCGGCC
ATGGACGGCAAGAACCAGGAATCGAGCTCGGAGGACATGATGGCGGCCTACGCCCTCAAGATGTGGGGGCGCGTC
TCGGCCGACGCCGAGTTGGAGGCTCGGTCGAACCTGCAGCTGTCGGTGCTGGCCCGCAGCCTTCGAGCCTATTAC
CTGTACGAGGCGGACAATTCGGTTCAGCCTCGACGCTTCATCGGCAACAAGGTGGCCGGCATCCTGTTTGAGAAC
AAGGTGGACCACACGACCTTTTTCGACGGCAGCATCGAGGCCATCCAGGGCATCCACATGATCCCCATCTTGCCG
CCCACGGCCTTTGTCCGCCGTCGACGCTTCGTGGCCGAGGAGTGGGAGACGTACTTTAGCCGAGGACGGATCGAC
GAGGTGGCCAGCGCCTGGAAGAGCATCATTTACGCCAGCTACGCCACCGTCGACCCGGCCGCTGCCTTTAAGTTT
TTCTCGTCGACATCCTTTCAGCCGCAGTGGTTGGATGGAGGCGCGTCGCTGACGTGGTTTATGGCGTATGCTGCC
GCACTTGGCGGGCTGTGA
Gene >Ophio5|7953
ATGGATCGGTGTCGTCTGTTATGGCTGGTCTTGTTGCTGACGGGCGGTGCCCAGGCGTCTGCCATCCGGACCAAT
AGCTCTCGAGCCGCCAGCCAGATTGCTTCGCTTTTGCAGGAGCAGCTCATTTTTTTCAATTCGGACCTGTGGAAC
CGAACGTTGTCGAGTGCAGGAGTCGAATTATCGCAGCACCGAGGAGGCCCCGTCTTGAACCAAGTTGCTGAACCA
GTCCTGAGCGGGCTTCGCCGGCAGAAGATCCACACGGCCCAACAGGCAGTGTCATCGACGCTCACGGCGGAGCAC
TTGGAAGCCACGAGGGCCCCGTTTTCTAACTGGACGTGGCGATCGTCGAGCGCACCGCCTAGATCCGAGGACGAG
GAGCTCGAGCAGCAGGCCGAGACCGGTCCCAACGACTACGTCATGGGAGAGGAACGCGACATCTTCTCGAAGCCC
ATCGATCTCAAGGCGCCGCCCGATATGATCCAGCGGCGGCAGGATCACCCAGTGCCGCGCAAGGGCATCAAGGCG
CGCGGGCCTCTGCAGACCAACAAGTTCTACGCCAACTTCTTCCTCGGCGACCAGCTGGGCCCCATCTACACGTTT
CCCTACTCGTTGCAGTGGGCCGGAGGCAAGGGGAGAACGGGCAGCCATGGCATGTCCATCAGCCACGTGGAGGCG
CACCAGCAGGTGTTTGGCGGCAAGGAACGCGTTAAGGGGGCGTCGTCGTTTTACATCAACCCGATCGGGATCCAG
TCGCTGGTCATCTCGGCGACGGAGCTCAGCAACAAGACGACACTGACGACGGACAGCCTGACGCCGCATTCGGTG
CGGGCGCACCTCAGCAAGGACGGTCAGTCGCCGCCCTCGGTTTCTTTCCCGCTGGTGCAGGGCATGGCGTGCGTG
ACGGCGCAGTTTGAGGGCGCGAAGCCGGTGTTGCAGTCGGGCGTCACGTTCAAGACGGTGACGCGGGTGACGCGC
GAGCCCAAGAAGGGCGTGGCCAAGTACAACTTTGTGCTGGCCGACGGCACGAGCTGGCGAGTGTACGGCTGGCAC
ACCAAGGGCGACGGACTGGAGCTGACGGTGGCCAACGACGGACGGGCCGAGTCGAAGCGACCCTTTACCGGGTTG
CTGCAAGTGTGCAAGGACCCCGGCACGGAGGGATCGGAAGCAGCGCTGGACGACGGCGCCGGCGTCTTCGCCGAG
ACGGTGGGGCTGTCGGGATGGGCGTCCGGACGAGAGGGCCGATATCGGCTCCGCTTCGAACGCGGCGGGCACAAG
GACGGACAGCTGAACATGTACGCGCTGCCTCACCACGTGGAGTCGTTTGACGATGGGACGCGAAAGCTGGTCAAG
GCCAAGGCGCAGCTACAGACGCCGACCAAGGGCGTGGCGACGCTGGTGTGCGGCGAGGAGTGGACGCTGGTAGAG
GCCGAGATGGCGGTGGACATGGGCTTCGCGCCGTGGCATCCGGAGCGAGGCAACGCCGACAAGCTGTCGCCCGAG
GCCAAGCGGACGATCCGGGCGGCGGCAGCGCGCGAGCTGGCGCAGGACATGGCGGCGCAATCCAACGTCGACTCC
ATGTACTTCAGCGGCAAGGCGCTGGCCAAGTTCGCGGCGGCGGTGTGGGTGGTGCATCGGATGGTGGGCGACGCC
GAGCTGGCTCAGACGGGGCTCAGGCGGCTCCAAGCGGCGTTTGCGACGTTCGCCAGCAACAGACAGCGCTTCCCG
TTGACGTACGAATCGGCCTGGGGCGGCGTGGTGTCGCGGGCGACGTACGACACGGGCGACGGCGGCGTCGACTTT
GGCAACTCGCTGTACAACGATCACCACTTCCACTACGGCTACCACATCCTGGCGGCGGCCATGATTGCCGACCTG
GATGAGGGCTGGGGCAAGGCCAACGCCGACTACGTCCGGACGCTGGTGCGCGACATTGCCAACCCGAGCGCGTCG
GACCGTCTCTTCCCCCAGTGGCGCTGCTTCGACTGGTATCACGGCCACAGCTGGGCTCACGGGCTGTACGCGGCC
ATGGACGGCAAGAACCAGGAATCGAGCTCGGAGGACATGATGGCGGCCTACGCCCTCAAGATGTGGGGGCGCGTC
TCGGCCGACGCCGAGTTGGAGGCTCGGTCGAACCTGCAGCTGTCGGTGCTGGCCCGCAGCCTTCGAGCCTATTAC
CTGTACGAGGCGGACAATTCGGTTCAGCCTCGACGCTTCATCGGCAACAAGGTGGCCGGCATCCTGTTTGAGAAC
AAGGTGGACCACACGACCTTTTTCGACGGCAGCATCGAGGCCATCCAGGGCATCCACATGATCCCCATCTTGCCG
CCCACGGCCTTTGTCCGCCGTCGACGCTTCGTGGCCGAGGAGTGGGAGACGTACTTTAGCCGAGGACGGATCGAC
GAGGTGGCCAGCGCCTGGAAGAGCATCATTTACGCCAGCTACGCCACCGTCGACCCGGCCGCTGCCTTTAAGTTT
TTCTCGTCGACATCCTTTCAGCCGCAGTGGTTGGATGGAGGCGCGTCGCTGACGTGGTTTATGGCGTATGCTGCC
GGTGAGTCTGTCTCTTTCTCTCTCTCTCCCTTGATTCTATCCTTCTTTTTTTTTCTCTCTCTATTTTGGCGTCTT
GGCGTCTTGACCATGTTTCTGACTGACGAGGGGGGTTGGGTGGCGCGCTTGTAGCACTTGGCGGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail