Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7952
Gene name
Locationscaffold_825:14..1865
Strand-
Gene length (bp)1851
Transcript length (bp)1302
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.1E-21 97 262
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.8E-21 300 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 44 433 2.0E-116
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 49 433 3.0E-109
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 80 432 1.0E-87
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 2 431 4.0E-84
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 69 431 5.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 44 433 2.0E-116
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 49 433 3.0E-109
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 80 432 1.0E-87
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 2 431 4.0E-84
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 69 431 5.0E-81
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 69 431 5.0E-80
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 69 431 2.0E-77
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 80 432 1.0E-76
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 69 431 1.0E-75
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 46 431 6.0E-71
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 46 431 1.0E-69
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 84 430 8.0E-69
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 84 431 2.0E-66
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 69 431 3.0E-66
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 84 431 9.0E-63
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 84 432 1.0E-57
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 84 427 8.0E-49
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 65 433 4.0E-31
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 62 267 3.0E-13
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 275 431 3.0E-12
sp|P55471|Y4HA_RHISN Putative ionic transporter y4hA OS=Rhizobium sp. (strain NGR234) GN=NGR_a03490 PE=3 SV=1 120 433 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 100 119 19
3 129 151 22
4 163 185 22
5 205 227 22
6 240 262 22
7 299 321 22
8 334 356 22
9 366 388 22
10 395 417 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 67.47 37.09 97.84
CcL In ants, during behavior modification 33.96 15.79 52.13
CcD In ants, recently dead 30.77 15.08 46.46

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.005499 yes
SC16a CcD 0.000286 yes
CcL CcD 0.750506 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7952
MNRKDDAAGERTPLINDQQSASGSAPAVQPSCPRPSGLCAFFLDSKHTPGRESGSVAVRGLAHTWHVTKVTLLSN
YVNFLLLFVPLGIVAGACHWNSTAVFTINFFAIIPLAAVLSFATEEISIKLGETMGGLLNATFGNAVELIVSIVA
LKDGQIEVVQSSMLGSILSNLLLVMGMCFLFGGIVHRGQNGQGTEQRFSPAVAQTTCSLMTLSSASLVIPAALYA
VLTQNGSDEKQNSILILSRGTAIILFLLYSLYLVFQLRTHSNLFDPESPPETATTEAVQHEAEEEAPAMSAPAAA
AVLVVVTVLVAICADYLVGSIDDIVATAHISKAFLGMILIPIVGNAAEHVTAVVVALRDKMDLAMGVAIGSSIQI
ALGVTPFLVIVGWIIGQPMSLHFETFQTVAFAVSVLVVTYTVQDGRSNYLEGAMLLAL
Coding >Ophio5|7952
ATGAATCGCAAAGACGACGCCGCTGGCGAGCGTACGCCCCTCATCAATGACCAACAGTCGGCCTCTGGATCCGCT
CCTGCTGTCCAGCCATCTTGTCCCCGGCCCTCCGGCTTATGTGCCTTCTTTCTCGACTCCAAGCACACGCCGGGC
AGGGAGAGCGGCAGCGTCGCCGTTCGTGGCCTCGCTCACACTTGGCACGTCACCAAAGTGACGCTCCTCAGCAAC
TATGTCAACTTCCTTCTCCTCTTCGTGCCACTCGGCATCGTCGCCGGCGCTTGCCACTGGAATTCGACGGCCGTC
TTCACCATCAACTTCTTTGCCATTATCCCCCTCGCCGCCGTCTTGTCCTTTGCGACCGAGGAGATTTCCATCAAG
CTCGGCGAGACTATGGGCGGTCTTCTTAACGCTACCTTTGGCAATGCCGTCGAATTGATTGTCAGTATCGTCGCC
CTCAAGGACGGTCAGATCGAAGTGGTACAGTCGTCTATGCTGGGCTCTATCCTGTCCAACCTGCTGCTCGTCATG
GGCATGTGCTTCCTCTTCGGCGGCATCGTTCATCGTGGCCAGAATGGTCAGGGCACCGAGCAGCGCTTCTCCCCC
GCCGTCGCCCAGACTACCTGCTCTCTCATGACGCTCTCCTCCGCCTCCCTCGTCATCCCCGCTGCCCTCTACGCC
GTCCTCACCCAAAATGGGTCGGATGAAAAGCAAAACAGCATCCTCATCCTGTCGAGAGGCACCGCCATCATTCTC
TTCCTGCTCTACTCCCTGTACCTCGTCTTTCAGCTACGCACCCACAGCAACCTGTTTGACCCGGAGAGTCCCCCC
GAGACTGCCACCACGGAGGCTGTCCAACATGAAGCGGAAGAGGAGGCGCCGGCCATGAGCGCCCCCGCTGCCGCC
GCCGTCCTCGTCGTCGTCACCGTCCTCGTCGCCATCTGCGCCGATTATCTGGTCGGGAGCATCGACGACATCGTC
GCCACCGCCCACATCAGCAAGGCCTTCCTCGGTATGATTCTGATTCCCATCGTTGGCAACGCCGCCGAGCACGTC
ACCGCCGTCGTCGTCGCCCTTCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATTGGCTCCTCGATACAAATC
GCCCTCGGCGTCACGCCCTTCCTCGTCATCGTCGGCTGGATCATCGGACAGCCCATGTCGCTGCACTTTGAGACG
TTCCAGACCGTTGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACCGTCCAGGACGGTCGGTCCAACTACCTC
GAGGGCGCAATGCTCCTCGCCCTG
Transcript >Ophio5|7952
ATGAATCGCAAAGACGACGCCGCTGGCGAGCGTACGCCCCTCATCAATGACCAACAGTCGGCCTCTGGATCCGCT
CCTGCTGTCCAGCCATCTTGTCCCCGGCCCTCCGGCTTATGTGCCTTCTTTCTCGACTCCAAGCACACGCCGGGC
AGGGAGAGCGGCAGCGTCGCCGTTCGTGGCCTCGCTCACACTTGGCACGTCACCAAAGTGACGCTCCTCAGCAAC
TATGTCAACTTCCTTCTCCTCTTCGTGCCACTCGGCATCGTCGCCGGCGCTTGCCACTGGAATTCGACGGCCGTC
TTCACCATCAACTTCTTTGCCATTATCCCCCTCGCCGCCGTCTTGTCCTTTGCGACCGAGGAGATTTCCATCAAG
CTCGGCGAGACTATGGGCGGTCTTCTTAACGCTACCTTTGGCAATGCCGTCGAATTGATTGTCAGTATCGTCGCC
CTCAAGGACGGTCAGATCGAAGTGGTACAGTCGTCTATGCTGGGCTCTATCCTGTCCAACCTGCTGCTCGTCATG
GGCATGTGCTTCCTCTTCGGCGGCATCGTTCATCGTGGCCAGAATGGTCAGGGCACCGAGCAGCGCTTCTCCCCC
GCCGTCGCCCAGACTACCTGCTCTCTCATGACGCTCTCCTCCGCCTCCCTCGTCATCCCCGCTGCCCTCTACGCC
GTCCTCACCCAAAATGGGTCGGATGAAAAGCAAAACAGCATCCTCATCCTGTCGAGAGGCACCGCCATCATTCTC
TTCCTGCTCTACTCCCTGTACCTCGTCTTTCAGCTACGCACCCACAGCAACCTGTTTGACCCGGAGAGTCCCCCC
GAGACTGCCACCACGGAGGCTGTCCAACATGAAGCGGAAGAGGAGGCGCCGGCCATGAGCGCCCCCGCTGCCGCC
GCCGTCCTCGTCGTCGTCACCGTCCTCGTCGCCATCTGCGCCGATTATCTGGTCGGGAGCATCGACGACATCGTC
GCCACCGCCCACATCAGCAAGGCCTTCCTCGGTATGATTCTGATTCCCATCGTTGGCAACGCCGCCGAGCACGTC
ACCGCCGTCGTCGTCGCCCTTCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATTGGCTCCTCGATACAAATC
GCCCTCGGCGTCACGCCCTTCCTCGTCATCGTCGGCTGGATCATCGGACAGCCCATGTCGCTGCACTTTGAGACG
TTCCAGACCGTTGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACCGTCCAGGACGGTCGGTCCAACTACCTC
GAGGGCGCAATGCTCCTCGCCCTGTAG
Gene >Ophio5|7952
ATGAATCGCAAAGACGACGCCGCTGGCGAGCGTACGCCCCTCATCAATGACCAACAGTCGGCCTCTGGATCCGCT
CCTGCTGTCCAGCCATCTTGTCCCCGGCCCTCCGGCTTATGTGCCTTCTTTCTCGACTCCAAGCACACGCCGGGC
AGGGAGAGCGGCAGCGTCGCCGTTCGTGGCCTCGCTCACACTTGGCACGTCACCAAAGTGACGCTCCTCAGCAGT
ACGCGCACCAGGCAGACCCGGCCATGTTGGTGATTTTCCTGAAAGCTAATAAGCATCGCAGACTATGTCAACTTC
CTTCTCCTCTTCGTGCCACTCGGCATCGTCGCCGGCGCTTGCCACTGGAATTCGACGGCCGTCTTCACCATCAAC
TTCTTTGCCATTATCCCCCTCGCCGCCGTCTTGTCCTTTGCGACCGAGGAGATTTCCATCAAGCTCGGCGAGACT
ATGGGCGGTCTTCTTAACGCTACCTTTGGCAATGCCGTCGAATTGATTGTCTGTCCGCCTTTTCTCTTCGCCCTT
GATCGTTCTGTCTGCTGACCCTTTTTTTTCCTTAGGTCAGTATCGTCGCCCTCAAGGACGGTCAGATCGAAGTGG
TACAGTCGTCTATGCTGGGCTCTATCCTGTCCAACCTGCTGCTCGTCATGGGCATGTGCTTCCTCTTCGGCGGCA
TCGTTCATCGTGGCCAGAATGGTCAGGGCACCGAGCAGCGCTTCTCCCCCGCCGTCGCCCAGACTACCTGCTCTC
TCATGACGCTCTCCTCCGCCTCCCTCGTCATCCCCGCTGCCGTGAGTCTCCGGCCCCGTCGTCGTCTAGTCGAGG
AGCGCTGACATGGCCCGCCAGCTCTACGCCGTCCTCACCCAAAATGGGTCGGATGAAAAGCAAAACAGCATCCTC
ATCCTGTCGAGAGGCACCGCCATCATTCTCTTCCTGCTCTACTCCCTGTACCTCGTCTTTCAGCTACGCACCCAC
AGCAACCTGTTTGACCCGGAGAGTCCCCCCGAGACTGCCACCACGGAGGCTGTCCAACATGAAGCGGAAGAGGAG
GCGCCGGCCATGAGCGCCCCCGCTGCCGCCGCCGTCCTCGTCGTCGTCACCGTCCTCGTCGCCATCTGCGCCGAT
TATCTGGTCGGGAGCATCGACGACATCGTCGCCACCGCCCACATCAGCAAGGCCTTCCTCGGTATGATTCTGATT
CCCATCGTTGGCAACGCCGCCGAGCACGTCACCGCCGTCGTCGTCGCCCTTCGCGACAAGATGGACCTGGCCATG
GGCGTCGCCATTGGCTCCTCGATACAAATCGCCCTCGGCGTCACGCCCTTCCTCGTCATCGTCGGCTGGATCATC
GGACAGCCCATGTCGCTGCACTTTGAGACGTGTACGTTTTGCATCTTCCACTCCTCGTCGGCTCCCGTCTAACAG
AGCCGAACAGTCCAGACCGTTGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACCGTCCAGGACGGTCGGTCC
AACTACCTCGAGGGCGCAATGCTCCTCGCCCTGTACATCATCATCGCCGTCGCNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNTTTTTTTTTTCCCTCTTCTTTCCTTATTTCTGTTTTCTTTTGTACTGGAGCCACCGTCCGGGGCCGGAAA
GCAGAGACGATTCGTGGCCAATACCCTGGGCTTTTGGGGGGGTCGAGAGAGTCATGAGACTACCTATTCCCTGTA
TTCGTACCTGCGTGTCGGCGACTTGGCTCCGTAGCGGGACTACCCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail