Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7952
Gene name
Locationscaffold_825:14..1865
Strand-
Gene length (bp)1851
Transcript length (bp)1302
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.1E-21 97 262
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.8E-21 300 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 44 433 2.0E-116
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 49 433 3.0E-109
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 80 432 1.0E-87
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 2 431 4.0E-84
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 69 431 5.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 44 433 2.0E-116
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 49 433 3.0E-109
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 80 432 1.0E-87
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 2 431 4.0E-84
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 69 431 5.0E-81
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 69 431 5.0E-80
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 69 431 2.0E-77
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 80 432 1.0E-76
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 69 431 1.0E-75
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 46 431 6.0E-71
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 46 431 1.0E-69
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 84 430 8.0E-69
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 84 431 2.0E-66
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 69 431 3.0E-66
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 84 431 9.0E-63
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 84 432 1.0E-57
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 84 427 8.0E-49
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 65 433 4.0E-31
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 62 267 3.0E-13
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 275 431 3.0E-12
sp|P55471|Y4HA_RHISN Putative ionic transporter y4hA OS=Rhizobium sp. (strain NGR234) GN=NGR_a03490 PE=3 SV=1 120 433 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 100 119 19
3 129 151 22
4 163 185 22
5 205 227 22
6 240 262 22
7 299 321 22
8 334 356 22
9 366 388 22
10 395 417 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7952
MNRKDDAAGERTPLINDQQSASGSAPAVQPSCPRPSGLCAFFLDSKHTPGRESGSVAVRGLAHTWHVTKVTLLSN
YVNFLLLFVPLGIVAGACHWNSTAVFTINFFAIIPLAAVLSFATEEISIKLGETMGGLLNATFGNAVELIVSIVA
LKDGQIEVVQSSMLGSILSNLLLVMGMCFLFGGIVHRGQNGQGTEQRFSPAVAQTTCSLMTLSSASLVIPAALYA
VLTQNGSDEKQNSILILSRGTAIILFLLYSLYLVFQLRTHSNLFDPESPPETATTEAVQHEAEEEAPAMSAPAAA
AVLVVVTVLVAICADYLVGSIDDIVATAHISKAFLGMILIPIVGNAAEHVTAVVVALRDKMDLAMGVAIGSSIQI
ALGVTPFLVIVGWIIGQPMSLHFETFQTVAFAVSVLVVTYTVQDGRSNYLEGAMLLAL
Coding >Ophio5|7952
ATGAATCGCAAAGACGACGCCGCTGGCGAGCGTACGCCCCTCATCAATGACCAACAGTCGGCCTCTGGATCCGCT
CCTGCTGTCCAGCCATCTTGTCCCCGGCCCTCCGGCTTATGTGCCTTCTTTCTCGACTCCAAGCACACGCCGGGC
AGGGAGAGCGGCAGCGTCGCCGTTCGTGGCCTCGCTCACACTTGGCACGTCACCAAAGTGACGCTCCTCAGCAAC
TATGTCAACTTCCTTCTCCTCTTCGTGCCACTCGGCATCGTCGCCGGCGCTTGCCACTGGAATTCGACGGCCGTC
TTCACCATCAACTTCTTTGCCATTATCCCCCTCGCCGCCGTCTTGTCCTTTGCGACCGAGGAGATTTCCATCAAG
CTCGGCGAGACTATGGGCGGTCTTCTTAACGCTACCTTTGGCAATGCCGTCGAATTGATTGTCAGTATCGTCGCC
CTCAAGGACGGTCAGATCGAAGTGGTACAGTCGTCTATGCTGGGCTCTATCCTGTCCAACCTGCTGCTCGTCATG
GGCATGTGCTTCCTCTTCGGCGGCATCGTTCATCGTGGCCAGAATGGTCAGGGCACCGAGCAGCGCTTCTCCCCC
GCCGTCGCCCAGACTACCTGCTCTCTCATGACGCTCTCCTCCGCCTCCCTCGTCATCCCCGCTGCCCTCTACGCC
GTCCTCACCCAAAATGGGTCGGATGAAAAGCAAAACAGCATCCTCATCCTGTCGAGAGGCACCGCCATCATTCTC
TTCCTGCTCTACTCCCTGTACCTCGTCTTTCAGCTACGCACCCACAGCAACCTGTTTGACCCGGAGAGTCCCCCC
GAGACTGCCACCACGGAGGCTGTCCAACATGAAGCGGAAGAGGAGGCGCCGGCCATGAGCGCCCCCGCTGCCGCC
GCCGTCCTCGTCGTCGTCACCGTCCTCGTCGCCATCTGCGCCGATTATCTGGTCGGGAGCATCGACGACATCGTC
GCCACCGCCCACATCAGCAAGGCCTTCCTCGGTATGATTCTGATTCCCATCGTTGGCAACGCCGCCGAGCACGTC
ACCGCCGTCGTCGTCGCCCTTCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATTGGCTCCTCGATACAAATC
GCCCTCGGCGTCACGCCCTTCCTCGTCATCGTCGGCTGGATCATCGGACAGCCCATGTCGCTGCACTTTGAGACG
TTCCAGACCGTTGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACCGTCCAGGACGGTCGGTCCAACTACCTC
GAGGGCGCAATGCTCCTCGCCCTG
Transcript >Ophio5|7952
ATGAATCGCAAAGACGACGCCGCTGGCGAGCGTACGCCCCTCATCAATGACCAACAGTCGGCCTCTGGATCCGCT
CCTGCTGTCCAGCCATCTTGTCCCCGGCCCTCCGGCTTATGTGCCTTCTTTCTCGACTCCAAGCACACGCCGGGC
AGGGAGAGCGGCAGCGTCGCCGTTCGTGGCCTCGCTCACACTTGGCACGTCACCAAAGTGACGCTCCTCAGCAAC
TATGTCAACTTCCTTCTCCTCTTCGTGCCACTCGGCATCGTCGCCGGCGCTTGCCACTGGAATTCGACGGCCGTC
TTCACCATCAACTTCTTTGCCATTATCCCCCTCGCCGCCGTCTTGTCCTTTGCGACCGAGGAGATTTCCATCAAG
CTCGGCGAGACTATGGGCGGTCTTCTTAACGCTACCTTTGGCAATGCCGTCGAATTGATTGTCAGTATCGTCGCC
CTCAAGGACGGTCAGATCGAAGTGGTACAGTCGTCTATGCTGGGCTCTATCCTGTCCAACCTGCTGCTCGTCATG
GGCATGTGCTTCCTCTTCGGCGGCATCGTTCATCGTGGCCAGAATGGTCAGGGCACCGAGCAGCGCTTCTCCCCC
GCCGTCGCCCAGACTACCTGCTCTCTCATGACGCTCTCCTCCGCCTCCCTCGTCATCCCCGCTGCCCTCTACGCC
GTCCTCACCCAAAATGGGTCGGATGAAAAGCAAAACAGCATCCTCATCCTGTCGAGAGGCACCGCCATCATTCTC
TTCCTGCTCTACTCCCTGTACCTCGTCTTTCAGCTACGCACCCACAGCAACCTGTTTGACCCGGAGAGTCCCCCC
GAGACTGCCACCACGGAGGCTGTCCAACATGAAGCGGAAGAGGAGGCGCCGGCCATGAGCGCCCCCGCTGCCGCC
GCCGTCCTCGTCGTCGTCACCGTCCTCGTCGCCATCTGCGCCGATTATCTGGTCGGGAGCATCGACGACATCGTC
GCCACCGCCCACATCAGCAAGGCCTTCCTCGGTATGATTCTGATTCCCATCGTTGGCAACGCCGCCGAGCACGTC
ACCGCCGTCGTCGTCGCCCTTCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATTGGCTCCTCGATACAAATC
GCCCTCGGCGTCACGCCCTTCCTCGTCATCGTCGGCTGGATCATCGGACAGCCCATGTCGCTGCACTTTGAGACG
TTCCAGACCGTTGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACCGTCCAGGACGGTCGGTCCAACTACCTC
GAGGGCGCAATGCTCCTCGCCCTGTAG
Gene >Ophio5|7952
ATGAATCGCAAAGACGACGCCGCTGGCGAGCGTACGCCCCTCATCAATGACCAACAGTCGGCCTCTGGATCCGCT
CCTGCTGTCCAGCCATCTTGTCCCCGGCCCTCCGGCTTATGTGCCTTCTTTCTCGACTCCAAGCACACGCCGGGC
AGGGAGAGCGGCAGCGTCGCCGTTCGTGGCCTCGCTCACACTTGGCACGTCACCAAAGTGACGCTCCTCAGCAGT
ACGCGCACCAGGCAGACCCGGCCATGTTGGTGATTTTCCTGAAAGCTAATAAGCATCGCAGACTATGTCAACTTC
CTTCTCCTCTTCGTGCCACTCGGCATCGTCGCCGGCGCTTGCCACTGGAATTCGACGGCCGTCTTCACCATCAAC
TTCTTTGCCATTATCCCCCTCGCCGCCGTCTTGTCCTTTGCGACCGAGGAGATTTCCATCAAGCTCGGCGAGACT
ATGGGCGGTCTTCTTAACGCTACCTTTGGCAATGCCGTCGAATTGATTGTCTGTCCGCCTTTTCTCTTCGCCCTT
GATCGTTCTGTCTGCTGACCCTTTTTTTTCCTTAGGTCAGTATCGTCGCCCTCAAGGACGGTCAGATCGAAGTGG
TACAGTCGTCTATGCTGGGCTCTATCCTGTCCAACCTGCTGCTCGTCATGGGCATGTGCTTCCTCTTCGGCGGCA
TCGTTCATCGTGGCCAGAATGGTCAGGGCACCGAGCAGCGCTTCTCCCCCGCCGTCGCCCAGACTACCTGCTCTC
TCATGACGCTCTCCTCCGCCTCCCTCGTCATCCCCGCTGCCGTGAGTCTCCGGCCCCGTCGTCGTCTAGTCGAGG
AGCGCTGACATGGCCCGCCAGCTCTACGCCGTCCTCACCCAAAATGGGTCGGATGAAAAGCAAAACAGCATCCTC
ATCCTGTCGAGAGGCACCGCCATCATTCTCTTCCTGCTCTACTCCCTGTACCTCGTCTTTCAGCTACGCACCCAC
AGCAACCTGTTTGACCCGGAGAGTCCCCCCGAGACTGCCACCACGGAGGCTGTCCAACATGAAGCGGAAGAGGAG
GCGCCGGCCATGAGCGCCCCCGCTGCCGCCGCCGTCCTCGTCGTCGTCACCGTCCTCGTCGCCATCTGCGCCGAT
TATCTGGTCGGGAGCATCGACGACATCGTCGCCACCGCCCACATCAGCAAGGCCTTCCTCGGTATGATTCTGATT
CCCATCGTTGGCAACGCCGCCGAGCACGTCACCGCCGTCGTCGTCGCCCTTCGCGACAAGATGGACCTGGCCATG
GGCGTCGCCATTGGCTCCTCGATACAAATCGCCCTCGGCGTCACGCCCTTCCTCGTCATCGTCGGCTGGATCATC
GGACAGCCCATGTCGCTGCACTTTGAGACGTGTACGTTTTGCATCTTCCACTCCTCGTCGGCTCCCGTCTAACAG
AGCCGAACAGTCCAGACCGTTGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACCGTCCAGGACGGTCGGTCC
AACTACCTCGAGGGCGCAATGCTCCTCGCCCTGTACATCATCATCGCCGTCGCNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNTTTTTTTTTTCCCTCTTCTTTCCTTATTTCTGTTTTCTTTTGTACTGGAGCCACCGTCCGGGGCCGGAAA
GCAGAGACGATTCGTGGCCAATACCCTGGGCTTTTGGGGGGGTCGAGAGAGTCATGAGACTACCTATTCCCTGTA
TTCGTACCTGCGTGTCGGCGACTTGGCTCCGTAGCGGGACTACCCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail