Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7950
Gene name
Locationscaffold_824:567..2821
Strand-
Gene length (bp)2254
Transcript length (bp)1776
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 5.9E-47 278 531

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59737|GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp1 PE=3 SV=1 244 578 7.0E-139
sp|Q95LL3|TB22B_MACFA TBC1 domain family member 22B OS=Macaca fascicularis GN=TBC1D22B PE=2 SV=1 77 578 7.0E-113
sp|Q9NU19|TB22B_HUMAN TBC1 domain family member 22B OS=Homo sapiens GN=TBC1D22B PE=1 SV=3 77 578 8.0E-113
sp|Q8WUA7|TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens GN=TBC1D22A PE=1 SV=2 227 578 1.0E-106
sp|Q8R5A6|TB22A_MOUSE TBC1 domain family member 22A OS=Mus musculus GN=Tbc1d22a PE=1 SV=3 111 578 2.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59737|GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp1 PE=3 SV=1 244 578 7.0E-139
sp|Q95LL3|TB22B_MACFA TBC1 domain family member 22B OS=Macaca fascicularis GN=TBC1D22B PE=2 SV=1 77 578 7.0E-113
sp|Q9NU19|TB22B_HUMAN TBC1 domain family member 22B OS=Homo sapiens GN=TBC1D22B PE=1 SV=3 77 578 8.0E-113
sp|Q8WUA7|TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens GN=TBC1D22A PE=1 SV=2 227 578 1.0E-106
sp|Q8R5A6|TB22A_MOUSE TBC1 domain family member 22A OS=Mus musculus GN=Tbc1d22a PE=1 SV=3 111 578 2.0E-106
sp|Q95KI1|TB22A_MACFA TBC1 domain family member 22A (Fragment) OS=Macaca fascicularis GN=TBC1D22A PE=2 SV=2 248 578 2.0E-106
sp|Q08484|GYP1_YEAST GTPase-activating protein GYP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP1 PE=1 SV=1 238 508 2.0E-88
sp|Q08484|GYP1_YEAST GTPase-activating protein GYP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP1 PE=1 SV=1 509 576 6.0E-23
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 356 547 1.0E-21
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 356 547 2.0E-21
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 274 563 6.0E-17
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 274 563 1.0E-16
sp|Q8TBP0|TBC16_HUMAN TBC1 domain family member 16 OS=Homo sapiens GN=TBC1D16 PE=2 SV=1 268 544 1.0E-15
sp|Q9URY3|YLOH_SCHPO TBC domain-containing protein C1952.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.17c PE=3 SV=4 365 573 8.0E-15
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 246 585 2.0E-11
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 340 549 2.0E-11
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 274 567 2.0E-11
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 340 566 5.0E-11
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 340 564 6.0E-11
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 364 549 2.0E-10
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 263 553 2.0E-09
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 251 564 2.0E-09
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 272 555 4.0E-09
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 246 555 5.0E-09
sp|Q80XQ2|TBCD5_MOUSE TBC1 domain family member 5 OS=Mus musculus GN=Tbc1d5 PE=1 SV=2 280 590 5.0E-09
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 239 565 1.0E-08
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 379 546 2.0E-08
sp|Q9HA65|TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens GN=TBC1D17 PE=1 SV=2 264 553 6.0E-08
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 266 564 2.0E-07
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 266 564 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7950
MWSSSGSGKKPAQSEMIQVDRSDSASPFWRPPARDNAARRGASTSSSRDSNIVVGAAYSHADMLKFDSLNVSGPS
RPKTPPFSSNAAKIRVHEASPPPRNSATGSSPPFKSYINFLSNTNDDWKTDEDEMLGYEDDDGDDFGLPSLSNMK
RRSKRMATQAKPDADRLSPALDGSFGRPVRRHSNSADIAVERPMPSYPMPKKSEGKILRPQYKEILRDPANALHL
ISYPSVPPNAAPKEADAINSKITRINKFKKLLQASAISLPDLRALAWSGVPEEVRAMTWQLLLSYLPTNSERRVA
TLQRKRKEYLDGVRQAFERAGGGAGAAGKARGLDEAIWHQISIDIPRTNPHIELYGYEATQRSLERILYLWAVRH
PASGYVQGINDLVTPFWQVFLALYIGDHNIETGMDPGQLPKSVLDAVEADSFWCLTKLLDGIQDHYIVAQPGIQR
QVGSLRDLTARIDAGLSRHLEHEGVEFIQFSFRWMNCLLMREISVQNTIRMWDTYLAEEQGFSEFHLYVCAALLV
KWSDKLVKMDFQEIMMFLQSLPTKTWTEKDIELLLSEAFIWQSLYKGSAAHLKSQSRRPAPTNLQL
Coding >Ophio5|7950
ATGTGGTCGTCTTCGGGCTCAGGCAAGAAGCCGGCCCAGTCGGAGATGATCCAGGTCGATCGATCCGACTCTGCC
TCGCCCTTCTGGAGGCCGCCGGCGCGCGACAATGCAGCAAGGCGAGGCGCATCGACCTCGTCATCACGCGACTCC
AATATCGTTGTCGGCGCCGCCTATTCGCACGCCGATATGCTCAAGTTCGACTCCTTAAACGTGTCCGGTCCCTCG
CGCCCCAAGACACCACCGTTTTCGTCCAACGCGGCCAAGATCCGCGTTCACGAAGCCTCGCCGCCACCGCGCAAT
TCGGCCACCGGCAGCTCGCCACCTTTCAAGAGCTACATTAACTTTTTGTCCAACACCAATGACGATTGGAAGACG
GATGAAGACGAAATGCTAGGCTACGAGGACGACGATGGCGACGATTTCGGCCTGCCCAGCCTCTCCAACATGAAA
CGGAGATCGAAGAGGATGGCGACGCAAGCCAAGCCTGACGCCGACCGCCTCTCCCCCGCTCTTGACGGCTCCTTT
GGCCGGCCGGTTAGACGTCACTCCAACAGCGCTGATATCGCCGTCGAGCGTCCGATGCCTTCTTATCCCATGCCT
AAGAAGAGCGAGGGGAAGATTCTTCGGCCGCAGTACAAGGAGATCTTGAGAGATCCCGCCAATGCCTTGCACCTC
ATCAGCTACCCCTCCGTCCCGCCCAACGCTGCCCCTAAGGAAGCAGACGCCATAAACTCCAAAATCACCCGAATC
AACAAATTCAAGAAGCTGCTGCAGGCATCCGCCATCTCCCTTCCGGACCTGCGGGCCCTCGCATGGTCCGGGGTG
CCGGAAGAAGTGCGCGCCATGACCTGGCAGCTTCTTCTGAGCTACCTCCCCACCAACAGCGAAAGGAGAGTGGCG
ACGCTGCAGCGGAAGCGCAAGGAATACCTGGACGGGGTGCGGCAGGCCTTTGAGCGGGCCGGCGGCGGCGCTGGA
GCGGCAGGCAAGGCCCGGGGCCTGGACGAGGCCATCTGGCATCAGATCAGCATCGACATCCCCCGCACGAACCCG
CACATCGAGCTGTACGGCTACGAGGCCACGCAGAGGTCGCTCGAGCGCATCCTCTACCTCTGGGCCGTCAGGCAC
CCGGCCAGCGGCTACGTCCAGGGCATCAATGACCTGGTGACGCCCTTTTGGCAGGTCTTCCTCGCCCTCTACATC
GGGGACCACAACATCGAGACCGGCATGGACCCCGGCCAGCTTCCCAAGTCGGTGCTGGACGCCGTCGAGGCCGAC
TCCTTTTGGTGCCTGACCAAGCTGCTCGACGGCATCCAGGACCACTACATTGTTGCCCAGCCCGGCATCCAGCGT
CAGGTCGGCTCCCTGCGCGATCTGACGGCCCGCATCGACGCCGGCCTGTCGAGACACCTGGAACACGAGGGCGTC
GAGTTTATACAGTTCAGCTTCCGCTGGATGAACTGCCTCCTCATGCGCGAGATTAGCGTACAGAACACGATCCGC
ATGTGGGACACCTACCTGGCCGAAGAGCAGGGTTTCTCCGAGTTCCATCTCTACGTCTGCGCCGCCCTACTGGTG
AAATGGTCGGACAAGCTGGTCAAGATGGACTTTCAGGAAATCATGATGTTCCTTCAGAGCCTGCCGACAAAGACG
TGGACCGAAAAGGATATCGAGTTGCTCCTCAGCGAGGCCTTCATCTGGCAGAGCCTCTACAAGGGCTCCGCCGCC
CATCTCAAGAGTCAGTCCCGGCGACCGGCCCCGACCAACTTGCAGCTG
Transcript >Ophio5|7950
ATGTGGTCGTCTTCGGGCTCAGGCAAGAAGCCGGCCCAGTCGGAGATGATCCAGGTCGATCGATCCGACTCTGCC
TCGCCCTTCTGGAGGCCGCCGGCGCGCGACAATGCAGCAAGGCGAGGCGCATCGACCTCGTCATCACGCGACTCC
AATATCGTTGTCGGCGCCGCCTATTCGCACGCCGATATGCTCAAGTTCGACTCCTTAAACGTGTCCGGTCCCTCG
CGCCCCAAGACACCACCGTTTTCGTCCAACGCGGCCAAGATCCGCGTTCACGAAGCCTCGCCGCCACCGCGCAAT
TCGGCCACCGGCAGCTCGCCACCTTTCAAGAGCTACATTAACTTTTTGTCCAACACCAATGACGATTGGAAGACG
GATGAAGACGAAATGCTAGGCTACGAGGACGACGATGGCGACGATTTCGGCCTGCCCAGCCTCTCCAACATGAAA
CGGAGATCGAAGAGGATGGCGACGCAAGCCAAGCCTGACGCCGACCGCCTCTCCCCCGCTCTTGACGGCTCCTTT
GGCCGGCCGGTTAGACGTCACTCCAACAGCGCTGATATCGCCGTCGAGCGTCCGATGCCTTCTTATCCCATGCCT
AAGAAGAGCGAGGGGAAGATTCTTCGGCCGCAGTACAAGGAGATCTTGAGAGATCCCGCCAATGCCTTGCACCTC
ATCAGCTACCCCTCCGTCCCGCCCAACGCTGCCCCTAAGGAAGCAGACGCCATAAACTCCAAAATCACCCGAATC
AACAAATTCAAGAAGCTGCTGCAGGCATCCGCCATCTCCCTTCCGGACCTGCGGGCCCTCGCATGGTCCGGGGTG
CCGGAAGAAGTGCGCGCCATGACCTGGCAGCTTCTTCTGAGCTACCTCCCCACCAACAGCGAAAGGAGAGTGGCG
ACGCTGCAGCGGAAGCGCAAGGAATACCTGGACGGGGTGCGGCAGGCCTTTGAGCGGGCCGGCGGCGGCGCTGGA
GCGGCAGGCAAGGCCCGGGGCCTGGACGAGGCCATCTGGCATCAGATCAGCATCGACATCCCCCGCACGAACCCG
CACATCGAGCTGTACGGCTACGAGGCCACGCAGAGGTCGCTCGAGCGCATCCTCTACCTCTGGGCCGTCAGGCAC
CCGGCCAGCGGCTACGTCCAGGGCATCAATGACCTGGTGACGCCCTTTTGGCAGGTCTTCCTCGCCCTCTACATC
GGGGACCACAACATCGAGACCGGCATGGACCCCGGCCAGCTTCCCAAGTCGGTGCTGGACGCCGTCGAGGCCGAC
TCCTTTTGGTGCCTGACCAAGCTGCTCGACGGCATCCAGGACCACTACATTGTTGCCCAGCCCGGCATCCAGCGT
CAGGTCGGCTCCCTGCGCGATCTGACGGCCCGCATCGACGCCGGCCTGTCGAGACACCTGGAACACGAGGGCGTC
GAGTTTATACAGTTCAGCTTCCGCTGGATGAACTGCCTCCTCATGCGCGAGATTAGCGTACAGAACACGATCCGC
ATGTGGGACACCTACCTGGCCGAAGAGCAGGGTTTCTCCGAGTTCCATCTCTACGTCTGCGCCGCCCTACTGGTG
AAATGGTCGGACAAGCTGGTCAAGATGGACTTTCAGGAAATCATGATGTTCCTTCAGAGCCTGCCGACAAAGACG
TGGACCGAAAAGGATATCGAGTTGCTCCTCAGCGAGGCCTTCATCTGGCAGAGCCTCTACAAGGGCTCCGCCGCC
CATCTCAAGAGTCAGTCCCGGCGACCGGCCCCGACCAACTTGCAGCTGTGA
Gene >Ophio5|7950
ATGTGGTCGTCTTCGGGCTCAGGCAAGAAGCCGGCCCAGTCGGTGAGTGGGAGCGCCCGCACATGAGTTGTTCGG
TTTGCTGACGCCTCGAGTTGCCGCAGGAGATGATCCAGGTCGGTACGTCGAAACGCCTCTTTCTCTCTGTGCCAT
CGTCGCCCTGGCTAACTGCGTTTATAGATCGATCCGAGTATGGCGCATCTCTCGTCCGGAGTCGGCCGTTGCTGA
TCATCTTTCCTCTCAAGCTCTGCCTCGCCCTTCTGGAGGCCGCCGGCGCGCGACAATGCAGCAAGGCGAGGCGCA
TCGACCTCGTCATCACGCGACTCCAATATCGTTGTCGGCGCCGCCTATTCGCACGCCGATATGCTCAAGTTCGAC
TCCTTGTACGTCGTCCCTCGATCATACCCACCCACCTCCTCCCTTCTCACTACCCGTTGGCCAACCCGTATCCAT
CCACTCGTCCATCAGAAACGTGTCCGGTCCCTCGCGCCCCAAGACACCACCGTTTTCGTCCAACGCGGCCAAGAT
CCGCGTTCACGAAGCCTCGCCGCCACCGCGCAATTCGGCCACCGGCAGCTCGCCACCTTTCAAGAGCTACATTAA
CTTTTTGTCCAACACCAATGACGATTGGAAGACGGATGAAGACGAAATGCTAGGCTACGAGGACGACGATGGCGA
CGATTTCGGCCTGCCCAGCCTCTCCAACATGAAACGGAGATCGAAGAGGATGGCGACGCAAGCCAAGCCTGACGC
CGACCGCCTCTCCCCCGCTCTTGACGGCTCCTTTGGCCGGCCGGTTAGACGTCACTCCAACAGCGCTGATATCGC
CGTCGAGCGTCCGATGCCTTCTTATCCCATGCCTAAGAAGAGCGAGGGGAAGATTCTTCGGCCGCAGTACAAGGA
GATCTTGAGAGGTTCGTGTGCGAAGACGACTGTCTTGCCCCGACGGCTACTGACCTTTCCACCCACCCCCCAAAG
ATCCCGCCAATGCCTTGCACCTCATCAGCTACCCCTCCGTCCCGCCCAACGCTGCCCCTAAGGAAGCAGACGCCA
TAAACTCCAAAATCACCCGAATCAACAAATTCAAGAAGCTGCTGCAGGCATCCGCCATCTCCCTTCCGGACCTGC
GGGCCCTCGCATGGTCCGGGGTGCCGGAAGAAGTGCGCGCCATGACCTGGCAGCTTCTTCTGAGCTACCTCCCCA
CCAACAGCGAAAGGAGAGTGGCGACGCTGCAGCGGAAGCGCAAGGAATACCTGGACGGGGTGCGGCAGGCCTTTG
AGCGGGCCGGCGGCGGCGCTGGAGCGGCAGGCAAGGCCCGGGGCCTGGACGAGGCCATCTGGCATCAGATCAGCA
TCGACATCCCCCGCACGAACCCGCACATCGAGCTGTACGGCTACGAGGCCACGCAGAGGTCGCTCGAGCGCATCC
TCTACCTCTGGGCCGTCAGGCACCCGGCCAGCGGCTACGTCCAGGGCATCAATGACCTGGTGACGCCCTTTTGGC
AGGTCTTCCTCGCCCTCTACATCGGGGACCACAACATCGAGACCGGCATGGACCCCGGCCAGCTTCCCAAGTCGG
TGCTGGACGCCGTCGAGGCCGACTCCTTTTGGTGCCTGACCAAGCTGCTCGACGGCATCCAGGACCACTACATTG
TTGCCCAGCCCGGCATCCAGCGTCAGGTCGGCTCCCTGCGCGATCTGACGGCCCGCATCGACGCCGGCCTGTCGA
GACACCTGGAACACGAGGGCGTCGAGTTTATACAGTTCAGCTTCCGCTGGATGAACTGCCTCCTCATGCGCGAGA
TTAGCGTACAGAACACGATCCGCATGTGGGACACCTACCTGGTCAGCCTTTCCTTTTCCTTTTTCCTTTCTTCTT
TTTTTCCTTTCTCCTTTTTTTCTTTTTTTTTCGGTCATCTTCTTCTCTCTTCCCCCCCCCCCCTTTATCCGTTGT
CTTTTACTTACGAACCCCCCTTCTCTCCTTCTCTGTCCCCTTGCAGGCCGAAGAGCAGGGTTTCTCCGAGTTCCA
TCTCTACGTCTGCGCCGCCCTACTGGTGAAATGGTCGGACAAGCTGGTCAAGATGGACTTTCAGGAAATCATGAT
GTTCCTTCAGAGCCTGCCGACAAAGACGTGGACCGAAAAGGATATCGAGTTGCTCCTCAGCGAGGCCTTCATCTG
GCAGAGCCTCTACAAGGGCTCCGCCGCCCATCTCAAGAGTCAGTCCCGGCGACCGGCCCCGACCAACTTGCAGCT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail