Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7949
Gene name
Locationscaffold_823:4457..6535
Strand+
Gene length (bp)2078
Transcript length (bp)1740
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 5.4E-07 45 195

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 4.57 1.34 7.80
CcL In ants, during behavior modification 0.50 0.00 1.13
CcD In ants, recently dead 1.16 0.09 2.23

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001647 yes
SC16a CcD 0.001851 yes
CcL CcD 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7949
MHGANIFFLAAALWLSWLGAGNTSSLPSNTILFRRSRAQLPVRIVYRGDERSPEEIRHTGGFQPWGRNWDANELS
YSIDRHYSAGPRGCGLDDYDENNPNYQFQSAFVSVTHELGTAQGYGDWMYEITATPNMLYVLDDDDEVYPQGEIF
ALGGVYWGQIRRYTRAPVTEGAHVQESDWILNPEYDAQLYERSEHVANTRVSVDFPSELIDGQADSGDEEIDSES
DDSQDRRPLYNTAVHFVDDHAYELVGSFPLQFAEYPLVNLDVPGPPHPQGTAVAEYPLVNFDDPEAPQPQGSAVV
GVEELVNRELRMYTELDSEQMNTFFPESSSPGNWKVERRSSKAGRTNDCCKLVSRIRKMKATKTHKKTHKDYYRV
KMCVSDTFHPSCTSIRAGRDGKCFNLPAELKNNVSSLRPQSAAGTCTFYQIPDCGGLSFNASWPGMSLYRRDDLG
LFNDQVQSLRCDGVKVCGRGMPDVPWCRRSHKFCDFVDELKVKFELGDEDSSSSGTWDTIMLSLSTARSSTVIQL
AKEPSAGFSIDKDIDLFETFKSEKIALADINNLGLLDLPNKGYNRKDAWQFKGK
Coding >Ophio5|7949
ATGCACGGCGCCAACATATTTTTCTTAGCCGCTGCTCTGTGGCTCTCTTGGCTAGGGGCTGGCAATACCTCTTCC
CTACCATCGAACACTATCCTTTTTCGTCGATCCCGTGCTCAACTACCGGTTCGAATAGTCTATCGTGGAGACGAG
AGGAGCCCTGAGGAGATTAGGCATACCGGCGGATTCCAGCCTTGGGGCCGGAACTGGGACGCAAACGAGTTATCA
TACTCTATAGATCGCCATTATTCCGCCGGTCCGCGCGGCTGTGGTCTGGACGATTACGACGAAAACAACCCAAAT
TACCAATTCCAATCGGCATTCGTTTCAGTAACACATGAGTTGGGAACAGCACAAGGGTATGGCGATTGGATGTAC
GAGATCACTGCGACACCAAATATGCTTTATGTACTCGACGACGACGACGAAGTATATCCCCAAGGTGAGATTTTC
GCCTTAGGCGGTGTTTACTGGGGACAGATAAGGAGATATACACGTGCACCGGTGACGGAAGGCGCCCACGTGCAA
GAGTCTGACTGGATCCTCAATCCGGAATACGATGCTCAACTCTATGAACGATCCGAACATGTCGCTAATACCCGC
GTGAGTGTCGACTTTCCCAGCGAGCTCATCGATGGTCAAGCCGACAGCGGCGACGAGGAAATCGATAGCGAAAGC
GATGATAGCCAAGACAGGCGCCCCCTTTATAACACGGCTGTGCATTTCGTGGATGACCATGCGTATGAACTCGTT
GGTAGCTTCCCGCTTCAGTTCGCGGAATACCCTCTTGTGAATCTCGACGTTCCAGGACCGCCGCACCCACAGGGA
ACCGCCGTTGCGGAATACCCTCTTGTGAATTTCGACGATCCAGAAGCGCCGCAGCCGCAGGGGAGCGCCGTTGTC
GGTGTGGAGGAACTAGTCAATAGAGAGCTGCGAATGTATACCGAACTCGACAGCGAACAAATGAACACGTTCTTC
CCCGAGAGCAGCTCGCCGGGGAACTGGAAAGTCGAACGAAGAAGTAGTAAAGCAGGCAGAACAAATGACTGCTGC
AAGCTGGTTTCTAGGATTAGGAAGATGAAGGCCACAAAGACGCACAAGAAGACGCACAAAGACTACTACCGCGTC
AAGATGTGCGTCAGTGATACCTTCCACCCATCGTGTACCAGCATCAGAGCCGGCCGAGATGGAAAGTGCTTTAAT
CTGCCGGCTGAATTGAAGAATAATGTGTCTTCATTACGTCCACAGTCGGCGGCCGGAACTTGCACTTTTTACCAA
ATACCTGACTGTGGCGGCCTTTCGTTCAACGCGTCCTGGCCGGGCATGTCTCTTTATCGCAGAGATGACTTAGGT
CTATTCAACGACCAGGTTCAATCGCTCCGCTGTGACGGCGTCAAGGTGTGTGGTCGCGGGATGCCCGATGTGCCA
TGGTGCCGGCGCAGCCACAAGTTCTGTGACTTCGTCGACGAACTCAAGGTCAAGTTTGAACTGGGAGACGAAGAT
TCGTCTTCGTCGGGAACTTGGGATACAATAATGCTCTCCCTCAGCACCGCTCGGTCGTCTACTGTGATTCAGCTA
GCGAAAGAACCCTCGGCAGGATTTTCTATCGACAAAGACATTGACCTGTTTGAGACATTCAAGTCCGAAAAGATA
GCCCTTGCGGATATTAACAATTTAGGGTTACTAGATCTACCTAACAAGGGGTATAATAGGAAGGACGCGTGGCAG
TTCAAAGGTAAG
Transcript >Ophio5|7949
ATGCACGGCGCCAACATATTTTTCTTAGCCGCTGCTCTGTGGCTCTCTTGGCTAGGGGCTGGCAATACCTCTTCC
CTACCATCGAACACTATCCTTTTTCGTCGATCCCGTGCTCAACTACCGGTTCGAATAGTCTATCGTGGAGACGAG
AGGAGCCCTGAGGAGATTAGGCATACCGGCGGATTCCAGCCTTGGGGCCGGAACTGGGACGCAAACGAGTTATCA
TACTCTATAGATCGCCATTATTCCGCCGGTCCGCGCGGCTGTGGTCTGGACGATTACGACGAAAACAACCCAAAT
TACCAATTCCAATCGGCATTCGTTTCAGTAACACATGAGTTGGGAACAGCACAAGGGTATGGCGATTGGATGTAC
GAGATCACTGCGACACCAAATATGCTTTATGTACTCGACGACGACGACGAAGTATATCCCCAAGGTGAGATTTTC
GCCTTAGGCGGTGTTTACTGGGGACAGATAAGGAGATATACACGTGCACCGGTGACGGAAGGCGCCCACGTGCAA
GAGTCTGACTGGATCCTCAATCCGGAATACGATGCTCAACTCTATGAACGATCCGAACATGTCGCTAATACCCGC
GTGAGTGTCGACTTTCCCAGCGAGCTCATCGATGGTCAAGCCGACAGCGGCGACGAGGAAATCGATAGCGAAAGC
GATGATAGCCAAGACAGGCGCCCCCTTTATAACACGGCTGTGCATTTCGTGGATGACCATGCGTATGAACTCGTT
GGTAGCTTCCCGCTTCAGTTCGCGGAATACCCTCTTGTGAATCTCGACGTTCCAGGACCGCCGCACCCACAGGGA
ACCGCCGTTGCGGAATACCCTCTTGTGAATTTCGACGATCCAGAAGCGCCGCAGCCGCAGGGGAGCGCCGTTGTC
GGTGTGGAGGAACTAGTCAATAGAGAGCTGCGAATGTATACCGAACTCGACAGCGAACAAATGAACACGTTCTTC
CCCGAGAGCAGCTCGCCGGGGAACTGGAAAGTCGAACGAAGAAGTAGTAAAGCAGGCAGAACAAATGACTGCTGC
AAGCTGGTTTCTAGGATTAGGAAGATGAAGGCCACAAAGACGCACAAGAAGACGCACAAAGACTACTACCGCGTC
AAGATGTGCGTCAGTGATACCTTCCACCCATCGTGTACCAGCATCAGAGCCGGCCGAGATGGAAAGTGCTTTAAT
CTGCCGGCTGAATTGAAGAATAATGTGTCTTCATTACGTCCACAGTCGGCGGCCGGAACTTGCACTTTTTACCAA
ATACCTGACTGTGGCGGCCTTTCGTTCAACGCGTCCTGGCCGGGCATGTCTCTTTATCGCAGAGATGACTTAGGT
CTATTCAACGACCAGGTTCAATCGCTCCGCTGTGACGGCGTCAAGGTGTGTGGTCGCGGGATGCCCGATGTGCCA
TGGTGCCGGCGCAGCCACAAGTTCTGTGACTTCGTCGACGAACTCAAGGTCAAGTTTGAACTGGGAGACGAAGAT
TCGTCTTCGTCGGGAACTTGGGATACAATAATGCTCTCCCTCAGCACCGCTCGGTCGTCTACTGTGATTCAGCTA
GCGAAAGAACCCTCGGCAGGATTTTCTATCGACAAAGACATTGACCTGTTTGAGACATTCAAGTCCGAAAAGATA
GCCCTTGCGGATATTAACAATTTAGGGTTACTAGATCTACCTAACAAGGGGTATAATAGGAAGGACGCGTGGCAG
TTCAAAGGTAAGTAA
Gene >Ophio5|7949
ATGCACGGCGCCAACATATTTTTCTTAGCCGCTGCTCTGTGGCTCTCTTGGCTAGGGGCTGGCAATACCTCTTCC
CTACCATCGAACACTATCCTTTTTCGTCGATCCCGTGCTCAACTACCGGTTCGAATAGTCTATCGTGGAGACGAG
AGGAGCCCTGAGGAGATTAGGCATACCGGCGGATTCCAGCCTTGGGGCCGGAACTGGGACGCAAACGAGTTATCA
TACTCTATAGATCGCCATTATTCCGCCGGTCCGCGCGGCTGTGGTCTGGACGATTACGACGAAAACAACCCAAAT
TACCAATTCCAATCGGCATTCGTTTCAGTAACACATGAGTTGGGAACAGCACAAGGGTATGGCGATTGGATGTAC
GAGATCACTGCGACACCAAATATGCTTTATGTACTCGACGACGACGACGAAGTATATCCCCAAGGTGAGATTTTC
GCCTTAGGCGGTGTTTACTGGGGACAGATAAGGAGATATACACGTGCACCGGTGACGGAAGGCGCCCACGTGCAA
GAGTCTGACTGGATCCTCAATCCGGAATACGATGCTCAACTCTATGAACGATCCGAACATGTCGCTAATACCCGC
GTGAGTGTCGACTTTCCCAGCGAGCTCATCGATGGTCAAGCCGACAGCGGCGACGAGGAAATCGATAGCGAAAGC
GATGATAGCCAAGACAGGCGCCCCCTTTATAACACGGCTGTGCATTTCGTGGATGACCATGCGTATGAACTCGTT
GGTAGCTTCCCGCTTCAGTTCGCGGAATACCCTCTTGTGAATCTCGACGTTCCAGGACCGCCGCACCCACAGGGA
ACCGCCGTTGCGGAATACCCTCTTGTGAATTTCGACGATCCAGAAGCGCCGCAGCCGCAGGGGAGCGCCGTTGTC
GGTGTGGAGGAACTAGGTAAGAAGAGAGGCAGCCCGACGAAGACACCGTGCATGCTAACATGGACCACATTAGTC
AATAGAGAGCTGCGAATGTATACCGAACTCGACAGCGAACAAATGAACACGTTCTTCCCCGAGAGCAGCGTGTTC
TTGAGGGAGCTCAATGATCCGAATAACCGTCAGGGCGCTTGTGCCGCATTACTCAACATTTAGTCGCCGGGGAAC
TGGAAAGTCGAACGAAGAAGTAGTAAAGCAGGTAAGGGCCATAGAGTGGCATATAAAGGGAACAGCAATGAGACT
GATGTTTTTTCCCCGCACGGCAAGGCAGAACAAATGACTGCTGCAAGCTGGTTTCTAGGATTAGGAAGATGAAGG
CCACAAAGACGCACAAGAAGACGCACAAAGACTACTACCGCGTCAAGATGTGCGTCAGTGATACCTTCCACCCAT
CGTGTACCAGCATCAGAGCCGGCCGAGATGGAAAGTGCTGTATGGCGTTTACGTCCCGTTTGGCTGCCAGTTCAC
ACTTCAGCCGTGTGTGATGACGCCGCTAACAGTTGGATCAAGTTAATCTGCCGGCTGAATTGAAGAATAATGTGT
CTTCATTACGTCCACAGTCGGCGGCCGGAACTTGCACTTTTTACCAGTTAGTTAATTGCCTTCCCTTCACTGATC
CGGGACACGATAATGGGTGGTTGACTATGCTATGCAGAATACCTGACTGTGGCGGCCTTTCGTTCAACGCGTCCT
GGCCGGGCATGTCTCTTTATCGCAGAGATGACTTAGGTCTATTCAACGACCAGGTTCAATCGCTCCGCTGTGACG
GCGTCAAGGTGTGTGGTCGCGGGATGCCCGATGTGCCATGGTGCCGGCGCAGCCACAAGTTCTGTGACTTCGTCG
ACGAACTCAAGGTCAAGTTTGAACTGGGAGACGAAGATTCGTCTTCGTCGGGAACTTGGGATACAATAATGCTCT
CCCTCAGCACCGCTCGGTCGTCTACTGTGATTCAGCTAGCGAAAGAACCCTCGGCAGGATTTTCTATCGACAAAG
ACATTGACCTGTTTGAGACATTCAAGTCCGAAAAGATAGCCCTTGCGGATATTAACAATTTAGGGTTACTAGATC
TACCTAACAAGGGGTATAATAGGAAGGACGCGTGGCAGTTCAAAGGTAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail