Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7947
Gene name
Locationscaffold_822:5388..5895
Strand-
Gene length (bp)507
Transcript length (bp)507
Coding sequence length (bp)504
Protein length (aa) 168

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 1 163 6.0E-28
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 27 159 1.0E-22
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 4 160 6.0E-21
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 3 159 4.0E-19
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 4 158 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 1 163 6.0E-28
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 27 159 1.0E-22
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 4 160 6.0E-21
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 3 159 4.0E-19
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 4 158 3.0E-16
sp|A6QQ24|PIGL_BOVIN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Bos taurus GN=PIGL PE=2 SV=1 5 158 4.0E-14
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 1 158 4.0E-12
sp|P23797|GPI12_YEAST N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI12 PE=1 SV=2 1 157 4.0E-11
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Mitochondrion 0.5454 0.2671 0.0951 0.2402 0.6678 0.2663 0.4755 0.5068 0.1901 0.056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2104
Ophiocordyceps australis map64 (Brazil) OphauB2|1914
Ophiocordyceps camponoti-floridani Ophcf2|01722
Ophiocordyceps kimflemingae Ophio5|7947 (this protein)
Ophiocordyceps subramaniannii Hirsu2|678

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7947
MTTEWPADKIASLLASAFTSSASDAPTIDVLITFDRHGVSSHPNHISLYHGATTFVASAPSVDLYALESVNVLRK
YISFFDLFLSPFFLSFFPSSAVEVDKEGKGEVGQAHPRRLLFVSRFDGFVAARRAMVNAHRSQMVWFRHLYILFS
RYMVVNDLRLERVPPVQR
Coding >Ophio5|7947
ATGACGACCGAGTGGCCCGCCGACAAGATCGCCTCTCTCCTCGCCAGCGCATTCACCTCGTCTGCCTCGGATGCG
CCTACCATCGACGTCCTCATCACCTTTGACCGCCACGGCGTCTCGTCCCATCCGAATCATATCTCGCTCTATCAC
GGCGCGACGACGTTTGTCGCCTCGGCTCCGTCCGTTGACCTGTACGCTCTCGAGTCTGTCAATGTGCTGCGCAAG
TACATCTCCTTCTTCGACCTTTTCCTCTCCCCATTCTTCCTCTCCTTCTTCCCCTCTTCGGCCGTCGAGGTCGAC
AAGGAGGGAAAGGGGGAGGTTGGTCAAGCCCATCCTCGTCGTCTGCTCTTCGTCAGCCGCTTCGACGGCTTCGTC
GCTGCTCGTAGGGCCATGGTAAACGCCCATCGCAGTCAGATGGTCTGGTTTCGTCACTTGTATATTCTCTTCAGT
AGGTACATGGTCGTCAATGACCTGCGACTGGAAAGGGTGCCACCGGTCCAGAGG
Transcript >Ophio5|7947
ATGACGACCGAGTGGCCCGCCGACAAGATCGCCTCTCTCCTCGCCAGCGCATTCACCTCGTCTGCCTCGGATGCG
CCTACCATCGACGTCCTCATCACCTTTGACCGCCACGGCGTCTCGTCCCATCCGAATCATATCTCGCTCTATCAC
GGCGCGACGACGTTTGTCGCCTCGGCTCCGTCCGTTGACCTGTACGCTCTCGAGTCTGTCAATGTGCTGCGCAAG
TACATCTCCTTCTTCGACCTTTTCCTCTCCCCATTCTTCCTCTCCTTCTTCCCCTCTTCGGCCGTCGAGGTCGAC
AAGGAGGGAAAGGGGGAGGTTGGTCAAGCCCATCCTCGTCGTCTGCTCTTCGTCAGCCGCTTCGACGGCTTCGTC
GCTGCTCGTAGGGCCATGGTAAACGCCCATCGCAGTCAGATGGTCTGGTTTCGTCACTTGTATATTCTCTTCAGT
AGGTACATGGTCGTCAATGACCTGCGACTGGAAAGGGTGCCACCGGTCCAGAGGTGA
Gene >Ophio5|7947
ATGACGACCGAGTGGCCCGCCGACAAGATCGCCTCTCTCCTCGCCAGCGCATTCACCTCGTCTGCCTCGGATGCG
CCTACCATCGACGTCCTCATCACCTTTGACCGCCACGGCGTCTCGTCCCATCCGAATCATATCTCGCTCTATCAC
GGCGCGACGACGTTTGTCGCCTCGGCTCCGTCCGTTGACCTGTACGCTCTCGAGTCTGTCAATGTGCTGCGCAAG
TACATCTCCTTCTTCGACCTTTTCCTCTCCCCATTCTTCCTCTCCTTCTTCCCCTCTTCGGCCGTCGAGGTCGAC
AAGGAGGGAAAGGGGGAGGTTGGTCAAGCCCATCCTCGTCGTCTGCTCTTCGTCAGCCGCTTCGACGGCTTCGTC
GCTGCTCGTAGGGCCATGGTAAACGCCCATCGCAGTCAGATGGTCTGGTTTCGTCACTTGTATATTCTCTTCAGT
AGGTACATGGTCGTCAATGACCTGCGACTGGAAAGGGTGCCACCGGTCCAGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail