Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7944
Gene name
Locationscaffold_822:207..1074
Strand+
Gene length (bp)867
Transcript length (bp)867
Coding sequence length (bp)864
Protein length (aa) 288

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00788 RA Ras association (RalGDS/AF-6) domain 2.9E-12 186 259

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25344|STE50_YEAST Protein STE50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE50 PE=1 SV=1 185 286 2.0E-16
sp|P36622|STE4_SCHPO Sexual differentiation protein ste4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste4 PE=2 SV=1 188 257 2.0E-06

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6589 0.3151 0.0375 0.176 0.2554 0.0041 0.1844 0.238 0.2235 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2118
Ophiocordyceps australis map64 (Brazil) OphauB2|1911
Ophiocordyceps camponoti-floridani Ophcf2|01724
Ophiocordyceps camponoti-rufipedis Ophun1|5739
Ophiocordyceps kimflemingae Ophio5|7944 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7944
MLPALRLAKDAQQPLPNVGDGSQAYSYEAILSPPAPTPPPGPTPGLMRSYSQRKILIGATSKGTSPTQPTHERTI
AEQALDPTNAAERAVMSSSHLAAMNGSSANTSSYPSPNIPSPTSPQNHLSGTTLASRSYSSASSSNRAGLGNDND
HGGYGQRDKGSSSAPPRRRETPVPDTPSTSNASVEIFKSFRVSMDDPCHKVLPAALKKYQINAPWDQYALYIVYG
DQERCLGMDEKPLILFKQLDKEGKKPMFMLRKTNSAQVDGGDPGSAGMARGAATGYDPPGGII
Coding >Ophio5|7944
ATGCTTCCGGCGCTGCGGCTGGCCAAGGACGCGCAGCAGCCGCTGCCCAACGTCGGCGACGGGTCCCAGGCCTAC
AGCTACGAAGCCATACTATCCCCACCGGCCCCTACGCCACCGCCAGGTCCGACGCCGGGACTGATGCGGTCCTAT
TCGCAGAGGAAAATCCTCATCGGCGCTACGTCCAAGGGGACCTCACCCACACAGCCGACGCACGAGAGAACGATA
GCCGAGCAAGCGTTGGACCCGACCAACGCGGCCGAGCGGGCCGTCATGTCGTCGTCGCACCTGGCGGCCATGAAC
GGCTCCAGCGCCAACACGTCGTCTTATCCTTCGCCCAACATACCGTCGCCGACGTCTCCGCAGAACCACCTGAGC
GGCACGACGCTCGCCTCGCGGTCCTACTCGTCGGCCTCGTCCAGCAATCGCGCGGGACTGGGCAACGACAACGAC
CACGGCGGCTACGGCCAGCGCGACAAGGGATCCAGCTCGGCGCCACCGCGTCGGCGCGAGACGCCGGTACCGGAC
ACGCCGAGCACGAGCAACGCGTCGGTGGAGATCTTCAAGTCGTTCCGCGTCAGCATGGACGACCCGTGTCACAAG
GTGCTACCGGCGGCGCTGAAGAAGTACCAGATCAACGCGCCGTGGGACCAGTACGCGCTGTACATTGTCTACGGT
GACCAGGAGCGGTGTCTGGGCATGGACGAGAAGCCGCTGATCCTGTTCAAGCAGTTGGACAAGGAGGGCAAGAAG
CCCATGTTTATGCTGCGCAAGACGAACAGCGCGCAGGTCGACGGCGGCGATCCGGGGAGCGCGGGGATGGCGAGG
GGGGCGGCGACGGGGTACGATCCGCCAGGGGGGATCATA
Transcript >Ophio5|7944
ATGCTTCCGGCGCTGCGGCTGGCCAAGGACGCGCAGCAGCCGCTGCCCAACGTCGGCGACGGGTCCCAGGCCTAC
AGCTACGAAGCCATACTATCCCCACCGGCCCCTACGCCACCGCCAGGTCCGACGCCGGGACTGATGCGGTCCTAT
TCGCAGAGGAAAATCCTCATCGGCGCTACGTCCAAGGGGACCTCACCCACACAGCCGACGCACGAGAGAACGATA
GCCGAGCAAGCGTTGGACCCGACCAACGCGGCCGAGCGGGCCGTCATGTCGTCGTCGCACCTGGCGGCCATGAAC
GGCTCCAGCGCCAACACGTCGTCTTATCCTTCGCCCAACATACCGTCGCCGACGTCTCCGCAGAACCACCTGAGC
GGCACGACGCTCGCCTCGCGGTCCTACTCGTCGGCCTCGTCCAGCAATCGCGCGGGACTGGGCAACGACAACGAC
CACGGCGGCTACGGCCAGCGCGACAAGGGATCCAGCTCGGCGCCACCGCGTCGGCGCGAGACGCCGGTACCGGAC
ACGCCGAGCACGAGCAACGCGTCGGTGGAGATCTTCAAGTCGTTCCGCGTCAGCATGGACGACCCGTGTCACAAG
GTGCTACCGGCGGCGCTGAAGAAGTACCAGATCAACGCGCCGTGGGACCAGTACGCGCTGTACATTGTCTACGGT
GACCAGGAGCGGTGTCTGGGCATGGACGAGAAGCCGCTGATCCTGTTCAAGCAGTTGGACAAGGAGGGCAAGAAG
CCCATGTTTATGCTGCGCAAGACGAACAGCGCGCAGGTCGACGGCGGCGATCCGGGGAGCGCGGGGATGGCGAGG
GGGGCGGCGACGGGGTACGATCCGCCAGGGGGGATCATATGA
Gene >Ophio5|7944
ATGCTTCCGGCGCTGCGGCTGGCCAAGGACGCGCAGCAGCCGCTGCCCAACGTCGGCGACGGGTCCCAGGCCTAC
AGCTACGAAGCCATACTATCCCCACCGGCCCCTACGCCACCGCCAGGTCCGACGCCGGGACTGATGCGGTCCTAT
TCGCAGAGGAAAATCCTCATCGGCGCTACGTCCAAGGGGACCTCACCCACACAGCCGACGCACGAGAGAACGATA
GCCGAGCAAGCGTTGGACCCGACCAACGCGGCCGAGCGGGCCGTCATGTCGTCGTCGCACCTGGCGGCCATGAAC
GGCTCCAGCGCCAACACGTCGTCTTATCCTTCGCCCAACATACCGTCGCCGACGTCTCCGCAGAACCACCTGAGC
GGCACGACGCTCGCCTCGCGGTCCTACTCGTCGGCCTCGTCCAGCAATCGCGCGGGACTGGGCAACGACAACGAC
CACGGCGGCTACGGCCAGCGCGACAAGGGATCCAGCTCGGCGCCACCGCGTCGGCGCGAGACGCCGGTACCGGAC
ACGCCGAGCACGAGCAACGCGTCGGTGGAGATCTTCAAGTCGTTCCGCGTCAGCATGGACGACCCGTGTCACAAG
GTGCTACCGGCGGCGCTGAAGAAGTACCAGATCAACGCGCCGTGGGACCAGTACGCGCTGTACATTGTCTACGGT
GACCAGGAGCGGTGTCTGGGCATGGACGAGAAGCCGCTGATCCTGTTCAAGCAGTTGGACAAGGAGGGCAAGAAG
CCCATGTTTATGCTGCGCAAGACGAACAGCGCGCAGGTCGACGGCGGCGATCCGGGGAGCGCGGGGATGGCGAGG
GGGGCGGCGACGGGGTACGATCCGCCAGGGGGGATCATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail