Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7932
Gene name
Locationscaffold_82:41464..41991
Strand+
Gene length (bp)527
Transcript length (bp)408
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.00 0.0 0.00
CcL In ants, during behavior modification 73.56 29.8 117.32
CcD In ants, recently dead 0.92 0.0 2.60

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 1.000000 no
CcL CcD 0.042628 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7932
MRLSVVIATLLTITVVRATALYCFGMKMVNNFTNLISFSNSIGLGNFISLDNSIALGNPISFSNSITLGNPHNLT
NFISLGNPIGLGEPHNLNNFINLSSPHSLGNFIRQTFHVPTAPSSVHSEARVTSTARTRP
Coding >Ophio5|7932
ATGAGGCTTTCCGTCGTCATCGCTACTCTTCTCACAATAACGGTAGTCAGAGCCACAGCTCTGTACTGCTTCGGC
ATGAAGATGGTCAACAATTTCACCAACCTCATCAGCTTCAGCAACTCCATTGGTCTCGGCAACTTCATCAGCCTC
GACAACTCCATCGCTCTCGGCAACCCCATCAGCTTCAGCAACTCCATCACTCTCGGTAACCCACACAATCTCACC
AACTTCATCAGCCTCGGCAACCCCATCGGTCTCGGCGAGCCCCACAATCTCAACAACTTCATCAACCTCAGCAGC
CCCCACAGTCTCGGAAACTTCATCCGTCAAACCTTTCATGTACCGACCGCTCCCTCCTCCGTTCATTCCGAGGCT
AGGGTGACTTCCACGGCACGAACACGGCCG
Transcript >Ophio5|7932
ATGAGGCTTTCCGTCGTCATCGCTACTCTTCTCACAATAACGGTAGTCAGAGCCACAGCTCTGTACTGCTTCGGC
ATGAAGATGGTCAACAATTTCACCAACCTCATCAGCTTCAGCAACTCCATTGGTCTCGGCAACTTCATCAGCCTC
GACAACTCCATCGCTCTCGGCAACCCCATCAGCTTCAGCAACTCCATCACTCTCGGTAACCCACACAATCTCACC
AACTTCATCAGCCTCGGCAACCCCATCGGTCTCGGCGAGCCCCACAATCTCAACAACTTCATCAACCTCAGCAGC
CCCCACAGTCTCGGAAACTTCATCCGTCAAACCTTTCATGTACCGACCGCTCCCTCCTCCGTTCATTCCGAGGCT
AGGGTGACTTCCACGGCACGAACACGGCCGTAG
Gene >Ophio5|7932
ATGAGGCTTTCCGTCGTCATCGCTACTCTTCTCACAATAACGGTAGTCAGAGCCACAGCTCTGTACTGCTTCGGC
ATGAAGATGGTCAAGTGCGAGAGATCAAGAATCTTGCTAGCTGCATCAAAAAATTCATCGATCTTGACAATTTCT
TCAGCAATTTCACCAACCTCATCAGCTTCAGCAACTCCATTGGTCTCGGCAACTTCATCAGCCTCGACAACTCCA
TCGCTCTCGGCAACCCCATCAGCTTCAGCAACTCCATCACTCTCGGTAACCCACACAATCTCACCAACTTCATCA
GCCTCGGCAACCCCATCGGTCTCGGCGAGCCCCACAATCTCAACAACTTCATCAACCTCAGCAGCCCCCACAGTC
TCGGAAACTTCATCCGTCAAACCTTTCAGTGGGTTATCAGCTGCTGGTTGACTTTCCTTTCATCAAGTGCTGATA
GAAGCAGTGTACCGACCGCTCCCTCCTCCGTTCATTCCGAGGCTAGGGTGACTTCCACGGCACGAACACGGCCGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail