Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|793
Gene name
Locationscaffold_122:23375..24215
Strand-
Gene length (bp)840
Transcript length (bp)639
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05529 Bap31 Bap31/Bap29 transmembrane region 5.8E-50 1 141
PF18035 Bap31_Bap29_C Bap31/Bap29 cytoplasmic coiled-coil domain 2.0E-11 163 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14290|YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.04 PE=4 SV=1 1 211 3.0E-38
sp|Q07451|YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET3 PE=1 SV=1 1 208 3.0E-30
sp|P35723|YET1_YEAST Endoplasmic reticulum transmembrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET1 PE=1 SV=2 15 194 7.0E-15
sp|Q54K74|YETL_DICDI Endoplasmic reticulum transmembrane protein YET-like OS=Dictyostelium discoideum GN=DDB_G0287543 PE=3 SV=2 1 202 6.0E-11
sp|Q9UHQ4|BAP29_HUMAN B-cell receptor-associated protein 29 OS=Homo sapiens GN=BCAP29 PE=1 SV=2 1 203 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14290|YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.04 PE=4 SV=1 1 211 3.0E-38
sp|Q07451|YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET3 PE=1 SV=1 1 208 3.0E-30
sp|P35723|YET1_YEAST Endoplasmic reticulum transmembrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET1 PE=1 SV=2 15 194 7.0E-15
sp|Q54K74|YETL_DICDI Endoplasmic reticulum transmembrane protein YET-like OS=Dictyostelium discoideum GN=DDB_G0287543 PE=3 SV=2 1 202 6.0E-11
sp|Q9UHQ4|BAP29_HUMAN B-cell receptor-associated protein 29 OS=Homo sapiens GN=BCAP29 PE=1 SV=2 1 203 2.0E-10
sp|Q04210|YET2_YEAST Endoplasmic reticulum transmembrane protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET2 PE=1 SV=1 1 184 2.0E-10
sp|Q5R9U7|BAP29_PONAB B-cell receptor-associated protein 29 OS=Pongo abelii GN=BCAP29 PE=2 SV=1 1 203 6.0E-10
sp|Q61334|BAP29_MOUSE B-cell receptor-associated protein 29 OS=Mus musculus GN=Bcap29 PE=1 SV=1 1 212 8.0E-10
sp|Q32KL9|BAP29_BOVIN B-cell receptor-associated protein 29 OS=Bos taurus GN=BCAP29 PE=2 SV=1 1 212 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 63 19
3 110 132 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 294.57 158.70 430.44
CcL In ants, during behavior modification 114.24 58.49 169.98
CcD In ants, recently dead 112.63 59.56 165.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.964565 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|793
MTLYYTLVFMLLMFEMGLFMLLLVPLPFNVKRRIFTFISENPLVAKVEYWMKITFVFILILFVDSVNRVYRVQQE
LLAASEQSSKGSTTIIGSERLEVQARKFYSQRNMYLCGFTLFLSLILNRTYVMIIQVMRLEDRLKSYEGTNKDTK
ESEKLAVAGKPGELAALKKELARKEEDLQTLKKQSSQLHKSYDELSDKYAALQKDNEASKDK
Coding >Ophio5|793
ATGACGCTCTACTATACGCTGGTCTTCATGCTGCTCATGTTCGAGATGGGGCTCTTTATGCTCCTTCTCGTGCCG
CTGCCCTTCAATGTGAAGAGGCGTATCTTTACCTTCATCTCGGAGAATCCACTGGTGGCCAAGGTGGAATATTGG
ATGAAGATTACCTTTGTCTTCATCCTTATCCTCTTCGTCGACAGCGTCAATCGTGTGTATCGTGTTCAGCAGGAG
CTTCTGGCTGCGTCGGAGCAGTCGTCCAAGGGATCCACTACCATCATTGGCTCTGAGCGGCTCGAGGTGCAGGCG
CGCAAGTTTTACTCGCAGCGGAACATGTACCTCTGCGGCTTCACCCTCTTCCTTTCTCTAATCCTCAACCGCACC
TACGTTATGATCATCCAGGTGATGCGCCTCGAGGACCGTCTCAAGTCGTACGAGGGTACCAACAAGGACACCAAG
GAGAGCGAGAAGCTGGCTGTTGCCGGCAAGCCCGGCGAGCTCGCGGCGCTGAAGAAGGAGCTGGCCCGCAAGGAG
GAGGATCTGCAGACGCTCAAGAAGCAGAGTAGCCAGCTCCACAAGAGCTACGACGAGCTGAGCGATAAGTACGCC
GCATTGCAGAAGGACAACGAGGCTAGCAAGGACAAA
Transcript >Ophio5|793
ATGACGCTCTACTATACGCTGGTCTTCATGCTGCTCATGTTCGAGATGGGGCTCTTTATGCTCCTTCTCGTGCCG
CTGCCCTTCAATGTGAAGAGGCGTATCTTTACCTTCATCTCGGAGAATCCACTGGTGGCCAAGGTGGAATATTGG
ATGAAGATTACCTTTGTCTTCATCCTTATCCTCTTCGTCGACAGCGTCAATCGTGTGTATCGTGTTCAGCAGGAG
CTTCTGGCTGCGTCGGAGCAGTCGTCCAAGGGATCCACTACCATCATTGGCTCTGAGCGGCTCGAGGTGCAGGCG
CGCAAGTTTTACTCGCAGCGGAACATGTACCTCTGCGGCTTCACCCTCTTCCTTTCTCTAATCCTCAACCGCACC
TACGTTATGATCATCCAGGTGATGCGCCTCGAGGACCGTCTCAAGTCGTACGAGGGTACCAACAAGGACACCAAG
GAGAGCGAGAAGCTGGCTGTTGCCGGCAAGCCCGGCGAGCTCGCGGCGCTGAAGAAGGAGCTGGCCCGCAAGGAG
GAGGATCTGCAGACGCTCAAGAAGCAGAGTAGCCAGCTCCACAAGAGCTACGACGAGCTGAGCGATAAGTACGCC
GCATTGCAGAAGGACAACGAGGCTAGCAAGGACAAATGA
Gene >Ophio5|793
ATGACGCTCTACTATACGCTGGTGGGTGGTGCCACGGCCGCGACGACAAGAGGGAAGGGCTACTGACGGGGATGA
GGGGCCGGCTCCCGGCTAGGTCTTCATGCTGCTCATGTTCGAGATGGGGCTCTTTATGCTCCTTCTCGTGCCGCT
GCCCTTCAATGTGAAGAGGCGTATCTTTACGTTCGTTGACGGGTTTGCCTCTTTTTTTAAAGGGGAAAAGGAGGG
TCCAATGGCTGACGAACCGGGGGGTAGCTTCATCTCGGAGAATCCACTGGTGGCCAAGGTGGAATATTGGATGAA
GATTACCTTTGTCTTCATCCTTATCCTCTTCGTCGACAGCGTCAATCGTGTGTATCGTGTTCAGCAGGAGCTTCT
GGCTGCGTCGGAGCAGTCGTCCAAGGGATCGTGGGTGCATCGCCTCCTCTTATCTGCAAGGCTGTGACACTGACT
CACAGCCGCAGCACTACCATCATTGGCTCTGAGCGGCTCGAGGTGCAGGCGCGCAAGTTTTACTCGCAGCGGAAC
ATGTACCTCTGCGGCTTCACCCTCTTCCTTTCTCTAATCCTCAACCGCACCTACGTTATGATCATCCAGGTGATG
CGCCTCGAGGACCGTCTCAAGTCGTACGAGGGTACCAACAAGGACACCAAGGAGAGCGAGAAGCTGGCTGTTGCC
GGCAAGCCCGGCGAGCTCGCGGCGCTGAAGAAGGAGCTGGCCCGCAAGGAGGAGGATCTGCAGACGCTCAAGAAG
CAGAGTAGCCAGCTCCACAAGAGCTACGACGAGCTGAGCGATAAGTACGCCGCATTGCAGAAGGACAACGAGGCT
AGCAAGGACAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail