Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7926
Gene name
Locationscaffold_82:28331..31196
Strand-
Gene length (bp)2865
Transcript length (bp)2865
Coding sequence length (bp)2862
Protein length (aa) 954

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 1.3E-08 617 680
PF09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 5.4E-21 709 858

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86ZU7|CO112_SCHPO Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 466 871 1.0E-33
sp|Q9UTM2|CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 466 871 1.0E-33
sp|P36056|RT22_YEAST 37S ribosomal protein S22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM22 PE=1 SV=1 482 895 2.0E-29
sp|Q2TBP8|MET17_BOVIN Methyltransferase-like protein 17, mitochondrial OS=Bos taurus GN=METTL17 PE=2 SV=1 618 857 3.0E-12
sp|Q9H7H0|MET17_HUMAN Methyltransferase-like protein 17, mitochondrial OS=Homo sapiens GN=METTL17 PE=1 SV=1 618 857 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86ZU7|CO112_SCHPO Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 466 871 1.0E-33
sp|Q9UTM2|CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 466 871 1.0E-33
sp|P36056|RT22_YEAST 37S ribosomal protein S22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM22 PE=1 SV=1 482 895 2.0E-29
sp|Q2TBP8|MET17_BOVIN Methyltransferase-like protein 17, mitochondrial OS=Bos taurus GN=METTL17 PE=2 SV=1 618 857 3.0E-12
sp|Q9H7H0|MET17_HUMAN Methyltransferase-like protein 17, mitochondrial OS=Homo sapiens GN=METTL17 PE=1 SV=1 618 857 3.0E-11
sp|Q3U2U7|MET17_MOUSE Methyltransferase-like protein 17, mitochondrial OS=Mus musculus GN=Mettl17 PE=2 SV=2 620 857 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0006412 translation Yes
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006518 peptide metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0043604 amide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1347 0.1524 0.0881 0.0557 0.8601 0.0443 0.0635 0.0406 0.1104 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2392
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6590
Ophiocordyceps australis map64 (Brazil) OphauB2|1497
Ophiocordyceps camponoti-floridani Ophcf2|00996
Ophiocordyceps camponoti-rufipedis Ophun1|297
Ophiocordyceps kimflemingae Ophio5|7926 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3377

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7926
MVLRGQAPEDPTRCIPPPPLQRMLPIASARRVRQGGARGRSSLAAWYRVACGPVPWRQPASVSFGQLQHGVSVRS
FGSSKNLQRPKESDDDDARRAREMERVVRETAQRFRGTLPKGYLTDEEYALYERLYGPPQRETEPEDVGIPTHAD
LGSWESSVEETEGKEVESDESDPQNPINEALEENQVDGTIPQTTSSKAAQDPIDDLTTMSETEVIEQTADSYVNA
VARNEREHRALLKLAEDFKATRRELQRKAEEQQKEMKRALKEKEEAALKNEFALREEELALRELWEEELYKARRK
EVKKSDTRKEDRKSMTQEENRKSMTQEENRKSMTQEEAETDDTQEEADTNDTQDEAETNTTKEEAELDRKLKRLR
NRPRRLLMQQLIVQEDEREEPLHRYHPWTLLGRFHERPLAIEMPLQQLGGPIRTMLARTHIDHIRQAARLLFSAS
DYSNSAGTIVGPKGGPMEGVLLTADQRSMSNIEADTFLAVQLPPLYASVMSVLREVRRRVGTEWLQSRLKQGESG
ALRILDAGAGGAALVAWDQIVQAEWEVLLEKKEVRNRYPAPSQKTALIAADRLRERVKYFLPDTTFLTRLPDYLH
SGETKGEHLEAGKERQSRKQYDIVVASHLLLKEEAGHNRQELLEKLWSLVRSDGGILVILERGHPRGFEAMAHAR
DTVLNKFLLPHPGFPLLDIDESKRDGKPKDDKREPGHIIAPCPTQGTCPMYKTAGLALGRKDFCHFDQKFMEPSY
YRSVLTGRGKNHGRVEFSYVAIRRGVGLGASVSGRQATRDAFDSYEDARSAPDMRLLPRQILRPLKKRRHVILDM
CTPDGGLERWTVPKSYGKLAYHDARKTKWGDLWALGAKTRVMRHIRSGLVEESNKMRDRFRRELRKQIEKKRPGG
GQEGDGKPVSKKLSKAQKKLKQQEARRKRKLRKLKLKERAEEAARKGIGKATDD
Coding >Ophio5|7926
ATGGTGCTCCGCGGGCAAGCTCCAGAGGATCCTACCCGTTGTATTCCCCCCCCCCCCCTTCAAAGGATGCTTCCA
ATTGCGAGCGCTCGCAGAGTCCGTCAGGGGGGGGCTCGCGGTCGTTCTTCACTGGCGGCATGGTATCGAGTCGCC
TGTGGTCCCGTCCCATGGCGACAGCCAGCTTCGGTTAGCTTTGGACAGCTCCAGCATGGCGTGAGCGTCCGATCA
TTCGGCAGCTCAAAAAACCTCCAGCGGCCCAAGGAATCCGATGATGACGACGCCAGGAGGGCGCGAGAAATGGAA
AGGGTGGTCCGCGAAACTGCTCAACGATTTCGCGGCACCCTTCCCAAGGGCTACCTCACAGATGAAGAATATGCC
CTCTACGAGCGTCTATACGGCCCGCCGCAGCGGGAGACGGAGCCGGAGGACGTCGGAATCCCTACACATGCCGAC
CTGGGATCGTGGGAGTCGAGCGTTGAGGAGACAGAGGGGAAGGAGGTGGAGTCGGACGAGTCAGATCCTCAGAAT
CCAATAAATGAGGCGTTGGAGGAGAATCAAGTGGACGGTACTATTCCTCAGACAACGTCGTCGAAAGCAGCGCAA
GACCCGATCGACGACTTGACCACCATGTCAGAGACTGAAGTTATCGAACAGACGGCAGACAGCTACGTCAACGCG
GTGGCGCGGAATGAGCGGGAGCACAGGGCGCTATTGAAGCTGGCTGAAGACTTCAAGGCGACGCGGAGAGAGCTT
CAGCGGAAGGCAGAGGAGCAGCAGAAGGAGATGAAGAGGGCACTCAAGGAGAAGGAGGAGGCCGCGTTGAAGAAC
GAGTTCGCCTTGCGAGAAGAGGAATTGGCTCTGCGGGAGCTCTGGGAGGAGGAGCTCTATAAGGCCAGGCGGAAA
GAAGTCAAGAAATCGGACACGCGGAAGGAGGACAGAAAGTCCATGACACAGGAGGAGAACAGAAAGTCCATGACA
CAGGAGGAGAACAGAAAGTCCATGACACAGGAGGAGGCCGAGACCGATGACACGCAGGAGGAGGCCGATACAAAT
GACACGCAGGATGAGGCCGAGACAAATACCACCAAGGAGGAGGCCGAACTGGACCGAAAGCTCAAGCGCCTTCGC
AATCGTCCAAGAAGGTTGCTCATGCAGCAGCTTATAGTGCAAGAGGACGAAAGGGAGGAACCTCTTCACCGATAT
CATCCTTGGACACTGCTGGGGAGGTTTCACGAACGGCCGTTGGCGATTGAGATGCCGCTTCAGCAGCTCGGCGGG
CCGATCCGTACCATGCTGGCCCGGACGCATATTGACCACATCAGGCAGGCTGCCAGGCTCTTATTTTCCGCCTCG
GATTACTCCAACTCGGCCGGAACCATCGTCGGCCCCAAGGGTGGCCCCATGGAGGGCGTGCTGCTGACCGCTGAC
CAGCGGAGCATGAGCAACATTGAGGCCGACACCTTCCTGGCCGTGCAACTGCCCCCCCTGTACGCCTCGGTCATG
AGCGTGCTTCGTGAAGTACGGAGGCGGGTCGGCACCGAGTGGCTGCAATCGCGACTGAAGCAGGGCGAAAGCGGG
GCGTTGAGAATCCTCGACGCCGGCGCAGGCGGCGCCGCCTTGGTCGCCTGGGATCAGATCGTCCAGGCCGAGTGG
GAGGTGCTCTTGGAAAAGAAGGAGGTGCGAAATCGTTATCCGGCGCCGAGTCAGAAGACTGCCCTCATAGCGGCG
GATCGTCTACGAGAGCGTGTCAAGTATTTCCTCCCTGACACGACCTTCCTTACGCGACTGCCCGATTATCTGCAC
TCGGGCGAGACCAAGGGCGAGCATCTCGAGGCCGGGAAGGAGAGACAGTCGCGGAAGCAGTACGACATTGTTGTG
GCCTCCCATCTGCTGCTCAAGGAAGAGGCTGGCCATAATCGACAGGAGCTTCTGGAGAAACTCTGGAGCCTGGTG
CGCAGCGACGGGGGGATCCTGGTCATACTGGAAAGGGGCCACCCGCGCGGCTTCGAGGCCATGGCGCACGCGCGA
GATACGGTGCTCAACAAGTTTCTGCTACCGCATCCCGGCTTCCCCTTGCTGGATATCGACGAGAGCAAAAGAGAT
GGAAAGCCAAAGGATGACAAGCGGGAGCCGGGACACATCATCGCGCCTTGCCCGACGCAGGGGACGTGTCCCATG
TACAAGACGGCCGGCCTCGCCCTAGGCCGCAAGGACTTTTGCCATTTTGACCAGAAGTTCATGGAGCCGAGTTAC
TACCGGTCGGTGCTGACAGGCAGGGGCAAGAACCATGGCCGGGTCGAGTTCAGCTACGTGGCGATTCGGCGCGGC
GTGGGACTCGGAGCATCGGTGAGCGGACGACAAGCGACAAGGGACGCCTTTGATAGTTACGAGGACGCCAGATCT
GCCCCGGACATGCGACTCCTCCCGCGTCAGATACTTCGTCCGCTCAAGAAGAGGCGACACGTGATACTCGACATG
TGCACGCCCGATGGCGGACTAGAGCGGTGGACTGTTCCCAAGAGCTACGGCAAATTGGCGTACCACGACGCTCGC
AAGACGAAATGGGGGGATCTTTGGGCTCTGGGTGCCAAGACGCGCGTTATGCGTCACATACGGTCCGGCTTGGTA
GAGGAAAGCAACAAGATGCGGGACAGGTTCCGCAGAGAGCTCAGGAAGCAGATCGAGAAGAAGAGGCCCGGTGGA
GGCCAGGAGGGAGACGGGAAGCCGGTTTCGAAGAAGCTTAGCAAGGCGCAGAAGAAACTGAAGCAGCAGGAGGCT
CGGAGGAAGAGGAAGCTGCGAAAGCTAAAGTTGAAGGAGCGGGCGGAAGAGGCGGCGCGGAAGGGGATTGGAAAG
GCGACCGACGAT
Transcript >Ophio5|7926
ATGGTGCTCCGCGGGCAAGCTCCAGAGGATCCTACCCGTTGTATTCCCCCCCCCCCCCTTCAAAGGATGCTTCCA
ATTGCGAGCGCTCGCAGAGTCCGTCAGGGGGGGGCTCGCGGTCGTTCTTCACTGGCGGCATGGTATCGAGTCGCC
TGTGGTCCCGTCCCATGGCGACAGCCAGCTTCGGTTAGCTTTGGACAGCTCCAGCATGGCGTGAGCGTCCGATCA
TTCGGCAGCTCAAAAAACCTCCAGCGGCCCAAGGAATCCGATGATGACGACGCCAGGAGGGCGCGAGAAATGGAA
AGGGTGGTCCGCGAAACTGCTCAACGATTTCGCGGCACCCTTCCCAAGGGCTACCTCACAGATGAAGAATATGCC
CTCTACGAGCGTCTATACGGCCCGCCGCAGCGGGAGACGGAGCCGGAGGACGTCGGAATCCCTACACATGCCGAC
CTGGGATCGTGGGAGTCGAGCGTTGAGGAGACAGAGGGGAAGGAGGTGGAGTCGGACGAGTCAGATCCTCAGAAT
CCAATAAATGAGGCGTTGGAGGAGAATCAAGTGGACGGTACTATTCCTCAGACAACGTCGTCGAAAGCAGCGCAA
GACCCGATCGACGACTTGACCACCATGTCAGAGACTGAAGTTATCGAACAGACGGCAGACAGCTACGTCAACGCG
GTGGCGCGGAATGAGCGGGAGCACAGGGCGCTATTGAAGCTGGCTGAAGACTTCAAGGCGACGCGGAGAGAGCTT
CAGCGGAAGGCAGAGGAGCAGCAGAAGGAGATGAAGAGGGCACTCAAGGAGAAGGAGGAGGCCGCGTTGAAGAAC
GAGTTCGCCTTGCGAGAAGAGGAATTGGCTCTGCGGGAGCTCTGGGAGGAGGAGCTCTATAAGGCCAGGCGGAAA
GAAGTCAAGAAATCGGACACGCGGAAGGAGGACAGAAAGTCCATGACACAGGAGGAGAACAGAAAGTCCATGACA
CAGGAGGAGAACAGAAAGTCCATGACACAGGAGGAGGCCGAGACCGATGACACGCAGGAGGAGGCCGATACAAAT
GACACGCAGGATGAGGCCGAGACAAATACCACCAAGGAGGAGGCCGAACTGGACCGAAAGCTCAAGCGCCTTCGC
AATCGTCCAAGAAGGTTGCTCATGCAGCAGCTTATAGTGCAAGAGGACGAAAGGGAGGAACCTCTTCACCGATAT
CATCCTTGGACACTGCTGGGGAGGTTTCACGAACGGCCGTTGGCGATTGAGATGCCGCTTCAGCAGCTCGGCGGG
CCGATCCGTACCATGCTGGCCCGGACGCATATTGACCACATCAGGCAGGCTGCCAGGCTCTTATTTTCCGCCTCG
GATTACTCCAACTCGGCCGGAACCATCGTCGGCCCCAAGGGTGGCCCCATGGAGGGCGTGCTGCTGACCGCTGAC
CAGCGGAGCATGAGCAACATTGAGGCCGACACCTTCCTGGCCGTGCAACTGCCCCCCCTGTACGCCTCGGTCATG
AGCGTGCTTCGTGAAGTACGGAGGCGGGTCGGCACCGAGTGGCTGCAATCGCGACTGAAGCAGGGCGAAAGCGGG
GCGTTGAGAATCCTCGACGCCGGCGCAGGCGGCGCCGCCTTGGTCGCCTGGGATCAGATCGTCCAGGCCGAGTGG
GAGGTGCTCTTGGAAAAGAAGGAGGTGCGAAATCGTTATCCGGCGCCGAGTCAGAAGACTGCCCTCATAGCGGCG
GATCGTCTACGAGAGCGTGTCAAGTATTTCCTCCCTGACACGACCTTCCTTACGCGACTGCCCGATTATCTGCAC
TCGGGCGAGACCAAGGGCGAGCATCTCGAGGCCGGGAAGGAGAGACAGTCGCGGAAGCAGTACGACATTGTTGTG
GCCTCCCATCTGCTGCTCAAGGAAGAGGCTGGCCATAATCGACAGGAGCTTCTGGAGAAACTCTGGAGCCTGGTG
CGCAGCGACGGGGGGATCCTGGTCATACTGGAAAGGGGCCACCCGCGCGGCTTCGAGGCCATGGCGCACGCGCGA
GATACGGTGCTCAACAAGTTTCTGCTACCGCATCCCGGCTTCCCCTTGCTGGATATCGACGAGAGCAAAAGAGAT
GGAAAGCCAAAGGATGACAAGCGGGAGCCGGGACACATCATCGCGCCTTGCCCGACGCAGGGGACGTGTCCCATG
TACAAGACGGCCGGCCTCGCCCTAGGCCGCAAGGACTTTTGCCATTTTGACCAGAAGTTCATGGAGCCGAGTTAC
TACCGGTCGGTGCTGACAGGCAGGGGCAAGAACCATGGCCGGGTCGAGTTCAGCTACGTGGCGATTCGGCGCGGC
GTGGGACTCGGAGCATCGGTGAGCGGACGACAAGCGACAAGGGACGCCTTTGATAGTTACGAGGACGCCAGATCT
GCCCCGGACATGCGACTCCTCCCGCGTCAGATACTTCGTCCGCTCAAGAAGAGGCGACACGTGATACTCGACATG
TGCACGCCCGATGGCGGACTAGAGCGGTGGACTGTTCCCAAGAGCTACGGCAAATTGGCGTACCACGACGCTCGC
AAGACGAAATGGGGGGATCTTTGGGCTCTGGGTGCCAAGACGCGCGTTATGCGTCACATACGGTCCGGCTTGGTA
GAGGAAAGCAACAAGATGCGGGACAGGTTCCGCAGAGAGCTCAGGAAGCAGATCGAGAAGAAGAGGCCCGGTGGA
GGCCAGGAGGGAGACGGGAAGCCGGTTTCGAAGAAGCTTAGCAAGGCGCAGAAGAAACTGAAGCAGCAGGAGGCT
CGGAGGAAGAGGAAGCTGCGAAAGCTAAAGTTGAAGGAGCGGGCGGAAGAGGCGGCGCGGAAGGGGATTGGAAAG
GCGACCGACGATTGA
Gene >Ophio5|7926
ATGGTGCTCCGCGGGCAAGCTCCAGAGGATCCTACCCGTTGTATTCCCCCCCCCCCCCTTCAAAGGATGCTTCCA
ATTGCGAGCGCTCGCAGAGTCCGTCAGGGGGGGGCTCGCGGTCGTTCTTCACTGGCGGCATGGTATCGAGTCGCC
TGTGGTCCCGTCCCATGGCGACAGCCAGCTTCGGTTAGCTTTGGACAGCTCCAGCATGGCGTGAGCGTCCGATCA
TTCGGCAGCTCAAAAAACCTCCAGCGGCCCAAGGAATCCGATGATGACGACGCCAGGAGGGCGCGAGAAATGGAA
AGGGTGGTCCGCGAAACTGCTCAACGATTTCGCGGCACCCTTCCCAAGGGCTACCTCACAGATGAAGAATATGCC
CTCTACGAGCGTCTATACGGCCCGCCGCAGCGGGAGACGGAGCCGGAGGACGTCGGAATCCCTACACATGCCGAC
CTGGGATCGTGGGAGTCGAGCGTTGAGGAGACAGAGGGGAAGGAGGTGGAGTCGGACGAGTCAGATCCTCAGAAT
CCAATAAATGAGGCGTTGGAGGAGAATCAAGTGGACGGTACTATTCCTCAGACAACGTCGTCGAAAGCAGCGCAA
GACCCGATCGACGACTTGACCACCATGTCAGAGACTGAAGTTATCGAACAGACGGCAGACAGCTACGTCAACGCG
GTGGCGCGGAATGAGCGGGAGCACAGGGCGCTATTGAAGCTGGCTGAAGACTTCAAGGCGACGCGGAGAGAGCTT
CAGCGGAAGGCAGAGGAGCAGCAGAAGGAGATGAAGAGGGCACTCAAGGAGAAGGAGGAGGCCGCGTTGAAGAAC
GAGTTCGCCTTGCGAGAAGAGGAATTGGCTCTGCGGGAGCTCTGGGAGGAGGAGCTCTATAAGGCCAGGCGGAAA
GAAGTCAAGAAATCGGACACGCGGAAGGAGGACAGAAAGTCCATGACACAGGAGGAGAACAGAAAGTCCATGACA
CAGGAGGAGAACAGAAAGTCCATGACACAGGAGGAGGCCGAGACCGATGACACGCAGGAGGAGGCCGATACAAAT
GACACGCAGGATGAGGCCGAGACAAATACCACCAAGGAGGAGGCCGAACTGGACCGAAAGCTCAAGCGCCTTCGC
AATCGTCCAAGAAGGTTGCTCATGCAGCAGCTTATAGTGCAAGAGGACGAAAGGGAGGAACCTCTTCACCGATAT
CATCCTTGGACACTGCTGGGGAGGTTTCACGAACGGCCGTTGGCGATTGAGATGCCGCTTCAGCAGCTCGGCGGG
CCGATCCGTACCATGCTGGCCCGGACGCATATTGACCACATCAGGCAGGCTGCCAGGCTCTTATTTTCCGCCTCG
GATTACTCCAACTCGGCCGGAACCATCGTCGGCCCCAAGGGTGGCCCCATGGAGGGCGTGCTGCTGACCGCTGAC
CAGCGGAGCATGAGCAACATTGAGGCCGACACCTTCCTGGCCGTGCAACTGCCCCCCCTGTACGCCTCGGTCATG
AGCGTGCTTCGTGAAGTACGGAGGCGGGTCGGCACCGAGTGGCTGCAATCGCGACTGAAGCAGGGCGAAAGCGGG
GCGTTGAGAATCCTCGACGCCGGCGCAGGCGGCGCCGCCTTGGTCGCCTGGGATCAGATCGTCCAGGCCGAGTGG
GAGGTGCTCTTGGAAAAGAAGGAGGTGCGAAATCGTTATCCGGCGCCGAGTCAGAAGACTGCCCTCATAGCGGCG
GATCGTCTACGAGAGCGTGTCAAGTATTTCCTCCCTGACACGACCTTCCTTACGCGACTGCCCGATTATCTGCAC
TCGGGCGAGACCAAGGGCGAGCATCTCGAGGCCGGGAAGGAGAGACAGTCGCGGAAGCAGTACGACATTGTTGTG
GCCTCCCATCTGCTGCTCAAGGAAGAGGCTGGCCATAATCGACAGGAGCTTCTGGAGAAACTCTGGAGCCTGGTG
CGCAGCGACGGGGGGATCCTGGTCATACTGGAAAGGGGCCACCCGCGCGGCTTCGAGGCCATGGCGCACGCGCGA
GATACGGTGCTCAACAAGTTTCTGCTACCGCATCCCGGCTTCCCCTTGCTGGATATCGACGAGAGCAAAAGAGAT
GGAAAGCCAAAGGATGACAAGCGGGAGCCGGGACACATCATCGCGCCTTGCCCGACGCAGGGGACGTGTCCCATG
TACAAGACGGCCGGCCTCGCCCTAGGCCGCAAGGACTTTTGCCATTTTGACCAGAAGTTCATGGAGCCGAGTTAC
TACCGGTCGGTGCTGACAGGCAGGGGCAAGAACCATGGCCGGGTCGAGTTCAGCTACGTGGCGATTCGGCGCGGC
GTGGGACTCGGAGCATCGGTGAGCGGACGACAAGCGACAAGGGACGCCTTTGATAGTTACGAGGACGCCAGATCT
GCCCCGGACATGCGACTCCTCCCGCGTCAGATACTTCGTCCGCTCAAGAAGAGGCGACACGTGATACTCGACATG
TGCACGCCCGATGGCGGACTAGAGCGGTGGACTGTTCCCAAGAGCTACGGCAAATTGGCGTACCACGACGCTCGC
AAGACGAAATGGGGGGATCTTTGGGCTCTGGGTGCCAAGACGCGCGTTATGCGTCACATACGGTCCGGCTTGGTA
GAGGAAAGCAACAAGATGCGGGACAGGTTCCGCAGAGAGCTCAGGAAGCAGATCGAGAAGAAGAGGCCCGGTGGA
GGCCAGGAGGGAGACGGGAAGCCGGTTTCGAAGAAGCTTAGCAAGGCGCAGAAGAAACTGAAGCAGCAGGAGGCT
CGGAGGAAGAGGAAGCTGCGAAAGCTAAAGTTGAAGGAGCGGGCGGAAGAGGCGGCGCGGAAGGGGATTGGAAAG
GCGACCGACGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail