Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7923
Gene name
Locationscaffold_82:19408..20092
Strand-
Gene length (bp)684
Transcript length (bp)594
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07956 DUF1690 Protein of Unknown function (DUF1690) 1.7E-34 58 184

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5ASP0|MIC19_EMENI MICOS complex subunit mic19 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8690 PE=1 SV=2 1 196 1.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7923
MGAGNSKQDDRADHLWKSSGPPSLSLGVLDSLQSDPEVSSNPRFSGPGSPRRSALPDSSRILSRLTRSPTQTDAS
RAKQRERHIQARVAEELKNLKKREAETLKLARARIAAEADADADDPGPDRFAVGKEVESLRRKLDERKQLRVLPD
PVEKTRNNVIRCLRDNDRRPLDCWKEVEAFKAEVKKMEDGWVEKVVS
Coding >Ophio5|7923
ATGGGTGCCGGCAACTCCAAGCAAGATGACCGGGCCGATCACTTGTGGAAGAGCTCAGGGCCACCATCCCTCTCC
CTCGGCGTTCTCGACTCACTACAATCAGACCCTGAGGTATCATCCAATCCCCGGTTCTCTGGCCCCGGATCCCCC
CGACGCTCCGCCCTCCCCGATTCTTCACGAATTCTGTCGAGGCTGACTCGCTCTCCCACCCAGACTGACGCCTCA
CGCGCCAAGCAAAGGGAGCGTCACATCCAAGCCCGCGTGGCCGAGGAGCTGAAGAATCTGAAGAAACGAGAAGCC
GAGACTTTGAAACTGGCTCGTGCTAGGATCGCGGCCGAAGCTGACGCCGACGCCGACGACCCGGGGCCAGATCGC
TTCGCCGTCGGCAAGGAGGTCGAGAGTCTGCGGCGGAAACTCGATGAGCGCAAGCAGCTGCGTGTCCTGCCTGAC
CCGGTTGAGAAGACTCGTAACAACGTCATACGCTGTTTGCGTGATAACGATCGTCGGCCTTTGGATTGCTGGAAG
GAGGTTGAAGCCTTCAAGGCTGAGGTGAAGAAGATGGAGGATGGATGGGTCGAGAAAGTGGTGTCA
Transcript >Ophio5|7923
ATGGGTGCCGGCAACTCCAAGCAAGATGACCGGGCCGATCACTTGTGGAAGAGCTCAGGGCCACCATCCCTCTCC
CTCGGCGTTCTCGACTCACTACAATCAGACCCTGAGGTATCATCCAATCCCCGGTTCTCTGGCCCCGGATCCCCC
CGACGCTCCGCCCTCCCCGATTCTTCACGAATTCTGTCGAGGCTGACTCGCTCTCCCACCCAGACTGACGCCTCA
CGCGCCAAGCAAAGGGAGCGTCACATCCAAGCCCGCGTGGCCGAGGAGCTGAAGAATCTGAAGAAACGAGAAGCC
GAGACTTTGAAACTGGCTCGTGCTAGGATCGCGGCCGAAGCTGACGCCGACGCCGACGACCCGGGGCCAGATCGC
TTCGCCGTCGGCAAGGAGGTCGAGAGTCTGCGGCGGAAACTCGATGAGCGCAAGCAGCTGCGTGTCCTGCCTGAC
CCGGTTGAGAAGACTCGTAACAACGTCATACGCTGTTTGCGTGATAACGATCGTCGGCCTTTGGATTGCTGGAAG
GAGGTTGAAGCCTTCAAGGCTGAGGTGAAGAAGATGGAGGATGGATGGGTCGAGAAAGTGGTGTCATGA
Gene >Ophio5|7923
ATGGGTGCCGGCAACTCCAAGCAAGATGACCGGGCCGATCACTTGTGGAAGAGGTATGATCTCACCTTGTCAACG
AACCCCTCAGAAATGCCATGACTCTGTCCAAACATTGCTAACGAAGAAAAAAAAAAAAAAAAAAACAGCTCAGGG
CCACCATCCCTCTCCCTCGGCGTTCTCGACTCACTACAATCAGACCCTGAGGTATCATCCAATCCCCGGTTCTCT
GGCCCCGGATCCCCCCGACGCTCCGCCCTCCCCGATTCTTCACGAATTCTGTCGAGGCTGACTCGCTCTCCCACC
CAGACTGACGCCTCACGCGCCAAGCAAAGGGAGCGTCACATCCAAGCCCGCGTGGCCGAGGAGCTGAAGAATCTG
AAGAAACGAGAAGCCGAGACTTTGAAACTGGCTCGTGCTAGGATCGCGGCCGAAGCTGACGCCGACGCCGACGAC
CCGGGGCCAGATCGCTTCGCCGTCGGCAAGGAGGTCGAGAGTCTGCGGCGGAAACTCGATGAGCGCAAGCAGCTG
CGTGTCCTGCCTGACCCGGTTGAGAAGACTCGTAACAACGTCATACGCTGTTTGCGTGATAACGATCGTCGGCCT
TTGGATTGCTGGAAGGAGGTTGAAGCCTTCAAGGCTGAGGTGAAGAAGATGGAGGATGGATGGGTCGAGAAAGTG
GTGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail