Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7917
Gene name
Locationscaffold_82:7733..8257
Strand+
Gene length (bp)524
Transcript length (bp)393
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74383|YNV8_SCHPO Uncharacterized protein C3H7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.08c PE=4 SV=1 26 123 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 36 55 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7917
MASIIARRLFSTSLRRLEHVVPKEELKQESKRNPELMILGGVMVAAIGGAGFYFARTPTSATSEAPVKIADSGMP
WESNTDGKYHYHPGGDPKKDPKQAPSALSVVVVPDVTLPKELHDKFNKWGKDGYP
Coding >Ophio5|7917
ATGGCTTCTATAATTGCCCGCCGTCTTTTCTCCACGTCGCTCCGTCGTCTGGAGCACGTCGTTCCCAAGGAGGAG
CTCAAACAAGAGTCGAAGCGCAACCCGGAACTGATGATACTCGGCGGCGTCATGGTCGCTGCCATCGGCGGCGCT
GGCTTCTACTTTGCCCGAACACCGACCAGCGCGACCTCGGAGGCCCCCGTCAAAATCGCCGACAGCGGCATGCCC
TGGGAGTCCAATACCGACGGCAAGTACCACTATCACCCCGGCGGCGATCCCAAGAAGGACCCCAAACAGGCGCCG
AGCGCCCTCAGCGTCGTCGTCGTGCCCGACGTCACCCTTCCCAAGGAGTTGCACGACAAATTCAACAAGTGGGGC
AAGGACGGCTATCCC
Transcript >Ophio5|7917
ATGGCTTCTATAATTGCCCGCCGTCTTTTCTCCACGTCGCTCCGTCGTCTGGAGCACGTCGTTCCCAAGGAGGAG
CTCAAACAAGAGTCGAAGCGCAACCCGGAACTGATGATACTCGGCGGCGTCATGGTCGCTGCCATCGGCGGCGCT
GGCTTCTACTTTGCCCGAACACCGACCAGCGCGACCTCGGAGGCCCCCGTCAAAATCGCCGACAGCGGCATGCCC
TGGGAGTCCAATACCGACGGCAAGTACCACTATCACCCCGGCGGCGATCCCAAGAAGGACCCCAAACAGGCGCCG
AGCGCCCTCAGCGTCGTCGTCGTGCCCGACGTCACCCTTCCCAAGGAGTTGCACGACAAATTCAACAAGTGGGGC
AAGGACGGCTATCCCTGA
Gene >Ophio5|7917
ATGGCTTCTATAATTGCCCGCCGTCTTTTCTCCACGTCGCTCCGTCGTCTGGAGCACGTCGTTCCCAAGGAGGAG
CTCAAACAAGAGTCGAAGCGCAACCCGGAACTGATGGTATGTTCGCCTCCCAAAGGACTCTTTCAGGTTGTAGAA
TCGCTGATACTCTCATCTTCTTCCTCGAACGTAGATACTCGGCGGCGTCATGGTCGCTGCCATCGGCGGCGCTGG
CTTCTACTTTGGTACGCCGACCGGACTACCATCGCCGTGCCGGCTGAGCTGACGTCTCCCTGAACTCAGCCCGAA
CACCGACCAGCGCGACCTCGGAGGCCCCCGTCAAAATCGCCGACAGCGGCATGCCCTGGGAGTCCAATACCGACG
GCAAGTACCACTATCACCCCGGCGGCGATCCCAAGAAGGACCCCAAACAGGCGCCGAGCGCCCTCAGCGTCGTCG
TCGTGCCCGACGTCACCCTTCCCAAGGAGTTGCACGACAAATTCAACAAGTGGGGCAAGGACGGCTATCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail