Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7906
Gene name
Locationscaffold_816:428..4145
Strand+
Gene length (bp)3717
Transcript length (bp)3717
Coding sequence length (bp)3714
Protein length (aa) 1238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.0E-18 9 100
PF00550 PP-binding Phosphopantetheine attachment site 7.4E-12 348 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 14 196 2.0E-20
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 3 189 1.0E-19
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2 199 4.0E-19
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 14 189 7.0E-18
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 3 196 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 14 196 2.0E-20
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 3 189 1.0E-19
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2 199 4.0E-19
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 14 189 7.0E-18
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 3 196 3.0E-16
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 7 212 1.0E-14
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 20 203 4.0E-14
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 25 188 1.0E-13
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 3 201 2.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 3 193 6.0E-13
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 3 196 1.0E-12
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 40 199 2.0E-12
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 40 199 2.0E-12
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 40 199 3.0E-12
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 40 199 4.0E-12
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 9 196 4.0E-12
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 40 199 5.0E-12
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 40 199 5.0E-12
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 40 199 5.0E-12
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 40 199 5.0E-12
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 40 199 5.0E-12
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 40 199 5.0E-12
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 40 199 6.0E-12
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 7 114 6.0E-12
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 40 199 6.0E-12
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 40 199 7.0E-12
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 40 199 7.0E-12
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 40 199 8.0E-12
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 40 199 8.0E-12
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 37 216 1.0E-11
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 3 202 1.0E-11
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 14 203 1.0E-11
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 5 158 1.0E-11
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 40 199 2.0E-11
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 40 199 2.0E-11
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 40 199 2.0E-11
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 7 199 2.0E-11
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 5 158 2.0E-11
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 40 199 2.0E-11
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 40 199 2.0E-11
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 40 199 4.0E-11
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 40 199 4.0E-11
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 40 199 4.0E-11
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 40 199 4.0E-11
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 40 199 5.0E-11
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 40 199 5.0E-11
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 40 199 5.0E-11
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 40 199 5.0E-11
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 10 204 5.0E-11
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 11 203 5.0E-11
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 3 218 6.0E-11
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 7 157 6.0E-11
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 16 209 6.0E-11
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 3 202 6.0E-11
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 9 199 6.0E-11
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 43 114 6.0E-11
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 3 196 8.0E-11
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 36 117 9.0E-11
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 39 199 1.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 14 199 1.0E-10
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 3 193 1.0E-10
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 7 114 1.0E-10
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 41 196 2.0E-10
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 3 202 2.0E-10
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 12 127 2.0E-10
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 16 204 2.0E-10
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 16 204 2.0E-10
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 34 204 2.0E-10
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 38 203 2.0E-10
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 40 199 3.0E-10
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 12 201 3.0E-10
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 40 199 3.0E-10
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 14 199 3.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 14 128 3.0E-10
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 41 192 3.0E-10
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 40 199 3.0E-10
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 10 204 4.0E-10
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 10 204 4.0E-10
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 39 199 5.0E-10
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 16 204 6.0E-10
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 14 116 6.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 17 115 6.0E-10
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 39 199 6.0E-10
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 41 124 6.0E-10
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 39 212 7.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 17 115 7.0E-10
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 12 127 7.0E-10
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 17 201 8.0E-10
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 40 196 1.0E-09
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 14 199 1.0E-09
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 7 199 1.0E-09
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 40 114 1.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 14 115 1.0E-09
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 39 196 1.0E-09
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 39 199 1.0E-09
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 41 199 2.0E-09
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 14 115 2.0E-09
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 41 203 2.0E-09
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 7 123 2.0E-09
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 14 202 2.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 14 199 3.0E-09
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 28 202 3.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 14 144 4.0E-09
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 12 127 4.0E-09
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 14 122 5.0E-09
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 14 202 5.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 14 115 5.0E-09
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 28 112 6.0E-09
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 25 202 6.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 14 115 6.0E-09
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 11 189 9.0E-09
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 36 204 1.0E-08
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 41 199 1.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 72 189 1.0E-08
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 43 111 1.0E-08
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 43 111 1.0E-08
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 14 125 1.0E-08
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 8 112 1.0E-08
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 43 114 1.0E-08
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 25 127 2.0E-08
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 43 116 2.0E-08
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 36 114 2.0E-08
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 41 199 2.0E-08
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 14 125 2.0E-08
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 3 189 2.0E-08
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 43 212 2.0E-08
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 41 124 2.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 43 188 2.0E-08
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 43 188 3.0E-08
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 28 125 3.0E-08
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 43 116 3.0E-08
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 43 116 3.0E-08
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 42 114 3.0E-08
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 25 182 4.0E-08
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 72 189 4.0E-08
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 41 204 4.0E-08
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 36 199 4.0E-08
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 25 128 4.0E-08
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 25 182 4.0E-08
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 43 212 4.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 65 189 5.0E-08
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 43 212 5.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 65 189 5.0E-08
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 72 210 6.0E-08
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 25 115 7.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 23 202 7.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 23 127 7.0E-08
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 24 203 8.0E-08
sp|A0R3D6|Y5435_MYCS2 Putative ligase MSMEG_5435/MSMEI_5285 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5435 PE=1 SV=1 21 113 9.0E-08
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 43 114 9.0E-08
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 39 196 9.0E-08
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 16 199 9.0E-08
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 39 212 1.0E-07
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 43 212 1.0E-07
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 41 128 1.0E-07
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 39 212 1.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 39 212 1.0E-07
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 39 204 1.0E-07
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 39 204 1.0E-07
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 43 195 2.0E-07
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 43 125 2.0E-07
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 13 144 2.0E-07
sp|B2HPY8|FAA30_MYCMM Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD30 PE=3 SV=1 24 153 2.0E-07
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 39 121 2.0E-07
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 39 121 2.0E-07
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 42 114 2.0E-07
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 25 153 2.0E-07
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 25 182 2.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 13 144 2.0E-07
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 69 196 2.0E-07
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 43 111 2.0E-07
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 43 111 3.0E-07
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 43 111 3.0E-07
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 43 212 3.0E-07
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 43 111 3.0E-07
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 43 111 3.0E-07
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 43 111 3.0E-07
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 43 111 3.0E-07
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 43 111 3.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 39 212 3.0E-07
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 37 137 3.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 16 189 3.0E-07
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 40 204 3.0E-07
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 13 196 4.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 14 125 4.0E-07
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 14 132 4.0E-07
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 41 128 4.0E-07
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 43 137 4.0E-07
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 39 115 5.0E-07
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 72 196 5.0E-07
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 14 196 5.0E-07
sp|Q9SFW5|AEE21_ARATH Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 41 137 5.0E-07
sp|Q9NR19|ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens GN=ACSS2 PE=1 SV=1 72 209 6.0E-07
sp|Q9QXG4|ACSA_MOUSE Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus GN=Acss2 PE=1 SV=2 72 209 7.0E-07
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 16 204 7.0E-07
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 72 196 8.0E-07
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 72 196 8.0E-07
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 25 153 8.0E-07
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 41 192 9.0E-07
sp|P9WQ57|FAA30_MYCTU Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD30 PE=1 SV=1 24 155 1.0E-06
sp|P9WQ56|FAA30_MYCTO Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD30 PE=3 SV=1 24 155 1.0E-06
sp|Q7U226|FAA30_MYCBO Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD30 PE=3 SV=1 24 155 1.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 292 416 1.0E-06
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 43 111 1.0E-06
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 65 146 1.0E-06
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 65 146 1.0E-06
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 72 209 2.0E-06
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 43 191 2.0E-06
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 11 125 2.0E-06
sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 72 207 2.0E-06
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 35 191 2.0E-06
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 43 137 2.0E-06
sp|P9WQ39|MENE_MYCTU Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menE PE=1 SV=1 43 203 2.0E-06
sp|P9WQ38|MENE_MYCTO Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menE PE=3 SV=1 43 203 2.0E-06
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 72 196 2.0E-06
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 73 196 2.0E-06
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 14 115 2.0E-06
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 72 196 3.0E-06
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 25 208 3.0E-06
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 69 210 3.0E-06
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 76 196 4.0E-06
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 40 130 4.0E-06
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 290 415 4.0E-06
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 14 125 4.0E-06
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 72 196 4.0E-06
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 72 196 4.0E-06
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 72 196 4.0E-06
sp|Q73ZP7|MBTM_MYCPA Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtM PE=3 SV=1 38 121 6.0E-06
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 35 144 6.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 11 125 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 496 518 22
2 727 749 22
3 970 992 22
4 1026 1048 22
5 1093 1115 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7906
MPISTPPLNYQLDREGTSGVSVGPELVILDSSSETKASPGSIGRICVRGEPVFHGYLLPDGSLDRGSFNADGWFD
TGDLGFMDHDGYLYITGRSKEVINRGGELISPLEVENAILAAAAQVDSPIYGRVSQALAFSVSHKVLQEAVAIVL
VTPPHTARVDLKALHKALRSSLQPVKWPVFITYMDDLPKRNSKVVRVGLGRRLRLPDLDEDMPYLHRHWQALCPP
PDTDVSVSIESWPCSVDYHEMSSRIEDVLPRYARHHCLKHEHCHDTFDVVLAPDEAGSVGQLQEELVQEVWKHLS
MCLDNYMMPDTIHMVPDALPRDEKGQVVDTELRQALERERRGQSTESKVVDAFASTLSLHSTDIPLDIDFFRLGG
DSLRAGRLLSALRSEFKVQLPISLVFNQGTVRAITEHLERSTTVKAERSEEEKGKTFGCRETHSSTNPLLMALQL
IPLAVVYPLRRAFQWTTFVVLLSQTQQWPTHKVVAGRLLNVLVCIMLARLAVMSLAPFFGIGAKWILIGRFRQGL
YPMWGGYHTRWWMVQKIQSICGMGVFGLSEPTTRIYYRLMGARVGSNVKLATSSLGEYDLLDIRDNAELTQSICR
PFAVEGNTSMYLGRITVGENSCVGIASVIAPGSNIPPNTCIGPNSSSWEMSDADESNRHLSPSSAPKPHWLLTLL
LTAPLTVAARLLSRLPWAAGLVGLVSHEPRSHETPMRDTLDWFTAGERVGYHFLALVLRTLCGPFLTLIFTVLVK
SLLDLLFGELGPSPAEKGSGAVAVWRAHLIKTLMPASRLHQLRAMFGQHYEPTSVMLRLLGGQIGKRVYWPGKGP
DMGDYHLLRVGDDVVFGSRSFLVTTDGYGSDHVTVRDGAMVADRVCLLPGVDVGEQTTMGSGALTRREAVYDAGA
TFVGSKGGDAICLSSSRRRRRNGSGVTLIDSHDNSSSSSNDTLADKTQHDSARGGKAETISPFGRAFYLGLGSYH
VFGPFTIFCYSTLFIAFTTCYWNAPSVLSIQAVDRLMNLFVARQDNYCLQLAVLFTLTWLVIAVLSTLQAVLALA
MEIAAKWLLLGRRQPGNYDWDKSSYCQRWQLLICVDHILRQCYLGHGIIGMLTGTSWIVLYYRALGAKMGKDCAL
FANGRPSLLFTEPDLITMGDRVAIDDASVVAHINTRGKFDLNRLEIESGCVLRSGSRLLSGAVMKKDSCLLEHTM
IMSGDVVNEGWTMQGWPADKFVGRRVHVGVGKGRKAHP
Coding >Ophio5|7906
ATGCCCATATCGACGCCGCCGCTCAACTACCAGCTAGATCGTGAAGGAACATCTGGCGTCAGTGTAGGTCCGGAA
CTGGTCATTCTCGACTCTTCGTCAGAAACAAAAGCGTCCCCTGGTTCGATTGGCCGGATCTGCGTCAGGGGCGAG
CCCGTCTTTCACGGCTATCTGCTCCCCGATGGCTCGTTGGATAGGGGCTCTTTCAACGCCGACGGATGGTTCGAC
ACGGGCGATCTTGGTTTCATGGATCATGACGGATATCTCTACATCACCGGCAGAAGCAAGGAAGTCATCAACCGC
GGCGGCGAGCTCATTTCGCCGCTCGAGGTGGAAAACGCCATCCTCGCGGCGGCGGCCCAGGTCGACTCACCCATC
TACGGCCGTGTGAGCCAGGCACTCGCCTTCTCCGTTTCCCACAAGGTGCTCCAAGAAGCGGTTGCCATCGTCCTG
GTGACGCCTCCGCACACGGCCAGGGTCGACCTGAAGGCTCTACACAAGGCGCTGCGGTCGTCCCTTCAGCCCGTC
AAGTGGCCCGTCTTCATCACCTACATGGACGACTTGCCCAAGAGGAACAGCAAGGTTGTGCGAGTCGGTCTGGGC
CGGCGCTTGCGTCTGCCGGATTTGGATGAGGACATGCCGTACTTGCATCGTCACTGGCAGGCGCTCTGTCCGCCG
CCTGACACGGATGTCTCTGTTTCCATCGAGTCTTGGCCTTGTTCGGTTGACTACCATGAGATGTCGAGCAGGATC
GAGGACGTCTTGCCTCGGTATGCGAGGCATCACTGTCTGAAGCATGAGCATTGTCATGACACGTTTGATGTCGTT
CTGGCTCCGGACGAAGCAGGCTCGGTCGGACAACTACAGGAGGAATTGGTCCAAGAGGTATGGAAGCATCTGTCT
ATGTGCTTGGATAACTACATGATGCCCGACACGATTCACATGGTGCCTGATGCTCTGCCGAGGGACGAAAAGGGT
CAAGTAGTCGACACGGAGCTTCGTCAGGCTTTAGAAAGAGAGCGGAGAGGCCAGAGCACGGAGAGCAAGGTTGTC
GACGCCTTCGCCAGCACCCTATCTCTTCACTCGACCGACATCCCGCTCGACATCGACTTCTTCCGTCTCGGAGGT
GATTCGCTGCGAGCCGGCCGTCTGCTATCGGCGCTCCGATCCGAGTTCAAGGTCCAGCTGCCCATCAGCCTCGTC
TTCAACCAGGGCACCGTCCGGGCCATCACGGAGCACCTGGAAAGATCAACAACGGTCAAGGCTGAAAGGTCCGAG
GAGGAAAAAGGGAAGACGTTTGGCTGTAGGGAGACGCACAGCTCGACCAATCCCCTTCTCATGGCTCTGCAGCTG
ATTCCCCTAGCTGTCGTCTATCCGCTACGACGTGCCTTCCAGTGGACGACCTTTGTCGTGCTGCTGAGCCAGACG
CAGCAGTGGCCGACGCACAAGGTCGTGGCGGGCCGCTTGCTCAATGTGCTGGTGTGCATTATGCTGGCTCGTCTG
GCCGTCATGTCCTTGGCCCCTTTCTTCGGCATCGGGGCCAAATGGATCCTCATCGGCCGCTTCCGTCAAGGCTTA
TATCCCATGTGGGGAGGCTATCATACGCGCTGGTGGATGGTGCAGAAGATACAGAGCATCTGCGGCATGGGCGTC
TTTGGCCTGAGCGAGCCTACTACACGCATCTACTATCGTCTGATGGGAGCTCGGGTGGGAAGCAACGTCAAGCTC
GCGACTTCATCCCTGGGCGAGTACGATCTCCTGGATATCCGGGACAACGCCGAGCTGACGCAGTCTATCTGCCGG
CCCTTTGCTGTCGAGGGCAATACCTCCATGTATCTCGGCCGGATCACGGTGGGAGAGAACAGCTGCGTCGGCATA
GCGTCCGTCATCGCCCCTGGATCCAATATCCCGCCCAACACCTGTATCGGTCCCAACTCTTCCAGCTGGGAGATG
TCCGACGCCGACGAGTCGAACCGTCATCTCTCACCCTCGAGCGCCCCCAAGCCGCACTGGCTACTGACGCTTCTC
CTTACCGCGCCCCTGACCGTCGCCGCCAGACTGTTGTCTCGCCTTCCTTGGGCCGCTGGCTTGGTCGGCTTGGTT
TCTCACGAGCCCCGTAGTCACGAAACGCCTATGCGGGACACGCTCGACTGGTTCACGGCCGGGGAGCGAGTCGGC
TATCACTTCCTTGCCCTTGTCCTCAGGACGCTCTGCGGCCCTTTCCTCACCTTGATCTTCACAGTACTGGTCAAA
TCCCTTCTGGATCTCCTCTTCGGCGAACTCGGTCCGAGCCCGGCCGAGAAGGGGTCCGGCGCCGTGGCAGTCTGG
CGCGCACATCTGATCAAGACGCTGATGCCGGCCAGTAGACTTCACCAGCTGAGGGCCATGTTCGGACAGCATTAC
GAGCCGACGTCGGTCATGCTCCGCTTGCTGGGCGGTCAAATCGGCAAGCGTGTCTACTGGCCGGGAAAGGGCCCG
GACATGGGCGATTACCACCTGCTCCGTGTTGGCGACGACGTCGTTTTCGGGTCCAGATCCTTTCTAGTTACGACT
GACGGTTATGGGTCGGATCACGTCACGGTCCGGGATGGGGCCATGGTCGCTGATCGCGTTTGCCTTCTTCCGGGC
GTTGATGTTGGTGAGCAGACGACGATGGGATCAGGGGCTCTCACACGCAGAGAAGCCGTCTACGATGCGGGAGCC
ACCTTTGTCGGCTCCAAAGGCGGCGATGCTATCTGTCTCTCCTCCTCTCGTCGTCGTCGTCGAAATGGCAGTGGC
GTCACACTCATCGATTCACACGACAATAGCAGCAGCAGCAGCAATGATACCCTGGCAGACAAGACACAGCACGAC
TCTGCACGGGGGGGTAAAGCCGAAACCATCTCGCCCTTTGGCCGCGCCTTTTACCTTGGCCTTGGCTCGTATCAT
GTTTTCGGTCCCTTCACCATCTTTTGTTACTCTACCCTCTTCATCGCCTTTACAACCTGCTACTGGAACGCTCCG
AGTGTCTTGTCTATACAGGCCGTGGACCGGTTGATGAACCTCTTCGTTGCCCGCCAAGACAACTATTGCCTCCAG
CTTGCCGTCCTCTTTACCCTGACCTGGCTCGTCATTGCCGTCCTTTCCACCTTGCAAGCCGTCCTCGCCTTGGCC
ATGGAGATTGCCGCCAAATGGCTTCTCCTCGGACGACGACAGCCGGGCAATTATGACTGGGATAAGTCGTCTTAC
TGTCAGAGGTGGCAGCTGCTGATTTGTGTCGACCACATATTACGCCAATGCTACCTCGGTCACGGCATCATCGGC
ATGCTGACGGGAACCAGCTGGATCGTTTTATACTATCGAGCTCTCGGCGCCAAGATGGGCAAGGATTGCGCTCTG
TTTGCCAACGGTCGCCCGAGCTTACTGTTTACGGAGCCTGATCTGATTACCATGGGTGATCGCGTCGCCATCGAC
GACGCCAGTGTTGTGGCTCATATTAATACCCGCGGCAAGTTCGACCTGAACAGGCTGGAGATTGAAAGCGGCTGC
GTCCTGCGCTCCGGCAGCAGGCTGCTGAGCGGAGCCGTTATGAAGAAGGATAGCTGCCTCCTGGAACATACCATG
ATTATGAGCGGTGATGTCGTCAACGAGGGATGGACAATGCAGGGCTGGCCGGCGGACAAGTTTGTCGGCCGACGA
GTGCATGTCGGCGTTGGGAAAGGACGAAAGGCTCATCCC
Transcript >Ophio5|7906
ATGCCCATATCGACGCCGCCGCTCAACTACCAGCTAGATCGTGAAGGAACATCTGGCGTCAGTGTAGGTCCGGAA
CTGGTCATTCTCGACTCTTCGTCAGAAACAAAAGCGTCCCCTGGTTCGATTGGCCGGATCTGCGTCAGGGGCGAG
CCCGTCTTTCACGGCTATCTGCTCCCCGATGGCTCGTTGGATAGGGGCTCTTTCAACGCCGACGGATGGTTCGAC
ACGGGCGATCTTGGTTTCATGGATCATGACGGATATCTCTACATCACCGGCAGAAGCAAGGAAGTCATCAACCGC
GGCGGCGAGCTCATTTCGCCGCTCGAGGTGGAAAACGCCATCCTCGCGGCGGCGGCCCAGGTCGACTCACCCATC
TACGGCCGTGTGAGCCAGGCACTCGCCTTCTCCGTTTCCCACAAGGTGCTCCAAGAAGCGGTTGCCATCGTCCTG
GTGACGCCTCCGCACACGGCCAGGGTCGACCTGAAGGCTCTACACAAGGCGCTGCGGTCGTCCCTTCAGCCCGTC
AAGTGGCCCGTCTTCATCACCTACATGGACGACTTGCCCAAGAGGAACAGCAAGGTTGTGCGAGTCGGTCTGGGC
CGGCGCTTGCGTCTGCCGGATTTGGATGAGGACATGCCGTACTTGCATCGTCACTGGCAGGCGCTCTGTCCGCCG
CCTGACACGGATGTCTCTGTTTCCATCGAGTCTTGGCCTTGTTCGGTTGACTACCATGAGATGTCGAGCAGGATC
GAGGACGTCTTGCCTCGGTATGCGAGGCATCACTGTCTGAAGCATGAGCATTGTCATGACACGTTTGATGTCGTT
CTGGCTCCGGACGAAGCAGGCTCGGTCGGACAACTACAGGAGGAATTGGTCCAAGAGGTATGGAAGCATCTGTCT
ATGTGCTTGGATAACTACATGATGCCCGACACGATTCACATGGTGCCTGATGCTCTGCCGAGGGACGAAAAGGGT
CAAGTAGTCGACACGGAGCTTCGTCAGGCTTTAGAAAGAGAGCGGAGAGGCCAGAGCACGGAGAGCAAGGTTGTC
GACGCCTTCGCCAGCACCCTATCTCTTCACTCGACCGACATCCCGCTCGACATCGACTTCTTCCGTCTCGGAGGT
GATTCGCTGCGAGCCGGCCGTCTGCTATCGGCGCTCCGATCCGAGTTCAAGGTCCAGCTGCCCATCAGCCTCGTC
TTCAACCAGGGCACCGTCCGGGCCATCACGGAGCACCTGGAAAGATCAACAACGGTCAAGGCTGAAAGGTCCGAG
GAGGAAAAAGGGAAGACGTTTGGCTGTAGGGAGACGCACAGCTCGACCAATCCCCTTCTCATGGCTCTGCAGCTG
ATTCCCCTAGCTGTCGTCTATCCGCTACGACGTGCCTTCCAGTGGACGACCTTTGTCGTGCTGCTGAGCCAGACG
CAGCAGTGGCCGACGCACAAGGTCGTGGCGGGCCGCTTGCTCAATGTGCTGGTGTGCATTATGCTGGCTCGTCTG
GCCGTCATGTCCTTGGCCCCTTTCTTCGGCATCGGGGCCAAATGGATCCTCATCGGCCGCTTCCGTCAAGGCTTA
TATCCCATGTGGGGAGGCTATCATACGCGCTGGTGGATGGTGCAGAAGATACAGAGCATCTGCGGCATGGGCGTC
TTTGGCCTGAGCGAGCCTACTACACGCATCTACTATCGTCTGATGGGAGCTCGGGTGGGAAGCAACGTCAAGCTC
GCGACTTCATCCCTGGGCGAGTACGATCTCCTGGATATCCGGGACAACGCCGAGCTGACGCAGTCTATCTGCCGG
CCCTTTGCTGTCGAGGGCAATACCTCCATGTATCTCGGCCGGATCACGGTGGGAGAGAACAGCTGCGTCGGCATA
GCGTCCGTCATCGCCCCTGGATCCAATATCCCGCCCAACACCTGTATCGGTCCCAACTCTTCCAGCTGGGAGATG
TCCGACGCCGACGAGTCGAACCGTCATCTCTCACCCTCGAGCGCCCCCAAGCCGCACTGGCTACTGACGCTTCTC
CTTACCGCGCCCCTGACCGTCGCCGCCAGACTGTTGTCTCGCCTTCCTTGGGCCGCTGGCTTGGTCGGCTTGGTT
TCTCACGAGCCCCGTAGTCACGAAACGCCTATGCGGGACACGCTCGACTGGTTCACGGCCGGGGAGCGAGTCGGC
TATCACTTCCTTGCCCTTGTCCTCAGGACGCTCTGCGGCCCTTTCCTCACCTTGATCTTCACAGTACTGGTCAAA
TCCCTTCTGGATCTCCTCTTCGGCGAACTCGGTCCGAGCCCGGCCGAGAAGGGGTCCGGCGCCGTGGCAGTCTGG
CGCGCACATCTGATCAAGACGCTGATGCCGGCCAGTAGACTTCACCAGCTGAGGGCCATGTTCGGACAGCATTAC
GAGCCGACGTCGGTCATGCTCCGCTTGCTGGGCGGTCAAATCGGCAAGCGTGTCTACTGGCCGGGAAAGGGCCCG
GACATGGGCGATTACCACCTGCTCCGTGTTGGCGACGACGTCGTTTTCGGGTCCAGATCCTTTCTAGTTACGACT
GACGGTTATGGGTCGGATCACGTCACGGTCCGGGATGGGGCCATGGTCGCTGATCGCGTTTGCCTTCTTCCGGGC
GTTGATGTTGGTGAGCAGACGACGATGGGATCAGGGGCTCTCACACGCAGAGAAGCCGTCTACGATGCGGGAGCC
ACCTTTGTCGGCTCCAAAGGCGGCGATGCTATCTGTCTCTCCTCCTCTCGTCGTCGTCGTCGAAATGGCAGTGGC
GTCACACTCATCGATTCACACGACAATAGCAGCAGCAGCAGCAATGATACCCTGGCAGACAAGACACAGCACGAC
TCTGCACGGGGGGGTAAAGCCGAAACCATCTCGCCCTTTGGCCGCGCCTTTTACCTTGGCCTTGGCTCGTATCAT
GTTTTCGGTCCCTTCACCATCTTTTGTTACTCTACCCTCTTCATCGCCTTTACAACCTGCTACTGGAACGCTCCG
AGTGTCTTGTCTATACAGGCCGTGGACCGGTTGATGAACCTCTTCGTTGCCCGCCAAGACAACTATTGCCTCCAG
CTTGCCGTCCTCTTTACCCTGACCTGGCTCGTCATTGCCGTCCTTTCCACCTTGCAAGCCGTCCTCGCCTTGGCC
ATGGAGATTGCCGCCAAATGGCTTCTCCTCGGACGACGACAGCCGGGCAATTATGACTGGGATAAGTCGTCTTAC
TGTCAGAGGTGGCAGCTGCTGATTTGTGTCGACCACATATTACGCCAATGCTACCTCGGTCACGGCATCATCGGC
ATGCTGACGGGAACCAGCTGGATCGTTTTATACTATCGAGCTCTCGGCGCCAAGATGGGCAAGGATTGCGCTCTG
TTTGCCAACGGTCGCCCGAGCTTACTGTTTACGGAGCCTGATCTGATTACCATGGGTGATCGCGTCGCCATCGAC
GACGCCAGTGTTGTGGCTCATATTAATACCCGCGGCAAGTTCGACCTGAACAGGCTGGAGATTGAAAGCGGCTGC
GTCCTGCGCTCCGGCAGCAGGCTGCTGAGCGGAGCCGTTATGAAGAAGGATAGCTGCCTCCTGGAACATACCATG
ATTATGAGCGGTGATGTCGTCAACGAGGGATGGACAATGCAGGGCTGGCCGGCGGACAAGTTTGTCGGCCGACGA
GTGCATGTCGGCGTTGGGAAAGGACGAAAGGCTCATCCCTAA
Gene >Ophio5|7906
ATGCCCATATCGACGCCGCCGCTCAACTACCAGCTAGATCGTGAAGGAACATCTGGCGTCAGTGTAGGTCCGGAA
CTGGTCATTCTCGACTCTTCGTCAGAAACAAAAGCGTCCCCTGGTTCGATTGGCCGGATCTGCGTCAGGGGCGAG
CCCGTCTTTCACGGCTATCTGCTCCCCGATGGCTCGTTGGATAGGGGCTCTTTCAACGCCGACGGATGGTTCGAC
ACGGGCGATCTTGGTTTCATGGATCATGACGGATATCTCTACATCACCGGCAGAAGCAAGGAAGTCATCAACCGC
GGCGGCGAGCTCATTTCGCCGCTCGAGGTGGAAAACGCCATCCTCGCGGCGGCGGCCCAGGTCGACTCACCCATC
TACGGCCGTGTGAGCCAGGCACTCGCCTTCTCCGTTTCCCACAAGGTGCTCCAAGAAGCGGTTGCCATCGTCCTG
GTGACGCCTCCGCACACGGCCAGGGTCGACCTGAAGGCTCTACACAAGGCGCTGCGGTCGTCCCTTCAGCCCGTC
AAGTGGCCCGTCTTCATCACCTACATGGACGACTTGCCCAAGAGGAACAGCAAGGTTGTGCGAGTCGGTCTGGGC
CGGCGCTTGCGTCTGCCGGATTTGGATGAGGACATGCCGTACTTGCATCGTCACTGGCAGGCGCTCTGTCCGCCG
CCTGACACGGATGTCTCTGTTTCCATCGAGTCTTGGCCTTGTTCGGTTGACTACCATGAGATGTCGAGCAGGATC
GAGGACGTCTTGCCTCGGTATGCGAGGCATCACTGTCTGAAGCATGAGCATTGTCATGACACGTTTGATGTCGTT
CTGGCTCCGGACGAAGCAGGCTCGGTCGGACAACTACAGGAGGAATTGGTCCAAGAGGTATGGAAGCATCTGTCT
ATGTGCTTGGATAACTACATGATGCCCGACACGATTCACATGGTGCCTGATGCTCTGCCGAGGGACGAAAAGGGT
CAAGTAGTCGACACGGAGCTTCGTCAGGCTTTAGAAAGAGAGCGGAGAGGCCAGAGCACGGAGAGCAAGGTTGTC
GACGCCTTCGCCAGCACCCTATCTCTTCACTCGACCGACATCCCGCTCGACATCGACTTCTTCCGTCTCGGAGGT
GATTCGCTGCGAGCCGGCCGTCTGCTATCGGCGCTCCGATCCGAGTTCAAGGTCCAGCTGCCCATCAGCCTCGTC
TTCAACCAGGGCACCGTCCGGGCCATCACGGAGCACCTGGAAAGATCAACAACGGTCAAGGCTGAAAGGTCCGAG
GAGGAAAAAGGGAAGACGTTTGGCTGTAGGGAGACGCACAGCTCGACCAATCCCCTTCTCATGGCTCTGCAGCTG
ATTCCCCTAGCTGTCGTCTATCCGCTACGACGTGCCTTCCAGTGGACGACCTTTGTCGTGCTGCTGAGCCAGACG
CAGCAGTGGCCGACGCACAAGGTCGTGGCGGGCCGCTTGCTCAATGTGCTGGTGTGCATTATGCTGGCTCGTCTG
GCCGTCATGTCCTTGGCCCCTTTCTTCGGCATCGGGGCCAAATGGATCCTCATCGGCCGCTTCCGTCAAGGCTTA
TATCCCATGTGGGGAGGCTATCATACGCGCTGGTGGATGGTGCAGAAGATACAGAGCATCTGCGGCATGGGCGTC
TTTGGCCTGAGCGAGCCTACTACACGCATCTACTATCGTCTGATGGGAGCTCGGGTGGGAAGCAACGTCAAGCTC
GCGACTTCATCCCTGGGCGAGTACGATCTCCTGGATATCCGGGACAACGCCGAGCTGACGCAGTCTATCTGCCGG
CCCTTTGCTGTCGAGGGCAATACCTCCATGTATCTCGGCCGGATCACGGTGGGAGAGAACAGCTGCGTCGGCATA
GCGTCCGTCATCGCCCCTGGATCCAATATCCCGCCCAACACCTGTATCGGTCCCAACTCTTCCAGCTGGGAGATG
TCCGACGCCGACGAGTCGAACCGTCATCTCTCACCCTCGAGCGCCCCCAAGCCGCACTGGCTACTGACGCTTCTC
CTTACCGCGCCCCTGACCGTCGCCGCCAGACTGTTGTCTCGCCTTCCTTGGGCCGCTGGCTTGGTCGGCTTGGTT
TCTCACGAGCCCCGTAGTCACGAAACGCCTATGCGGGACACGCTCGACTGGTTCACGGCCGGGGAGCGAGTCGGC
TATCACTTCCTTGCCCTTGTCCTCAGGACGCTCTGCGGCCCTTTCCTCACCTTGATCTTCACAGTACTGGTCAAA
TCCCTTCTGGATCTCCTCTTCGGCGAACTCGGTCCGAGCCCGGCCGAGAAGGGGTCCGGCGCCGTGGCAGTCTGG
CGCGCACATCTGATCAAGACGCTGATGCCGGCCAGTAGACTTCACCAGCTGAGGGCCATGTTCGGACAGCATTAC
GAGCCGACGTCGGTCATGCTCCGCTTGCTGGGCGGTCAAATCGGCAAGCGTGTCTACTGGCCGGGAAAGGGCCCG
GACATGGGCGATTACCACCTGCTCCGTGTTGGCGACGACGTCGTTTTCGGGTCCAGATCCTTTCTAGTTACGACT
GACGGTTATGGGTCGGATCACGTCACGGTCCGGGATGGGGCCATGGTCGCTGATCGCGTTTGCCTTCTTCCGGGC
GTTGATGTTGGTGAGCAGACGACGATGGGATCAGGGGCTCTCACACGCAGAGAAGCCGTCTACGATGCGGGAGCC
ACCTTTGTCGGCTCCAAAGGCGGCGATGCTATCTGTCTCTCCTCCTCTCGTCGTCGTCGTCGAAATGGCAGTGGC
GTCACACTCATCGATTCACACGACAATAGCAGCAGCAGCAGCAATGATACCCTGGCAGACAAGACACAGCACGAC
TCTGCACGGGGGGGTAAAGCCGAAACCATCTCGCCCTTTGGCCGCGCCTTTTACCTTGGCCTTGGCTCGTATCAT
GTTTTCGGTCCCTTCACCATCTTTTGTTACTCTACCCTCTTCATCGCCTTTACAACCTGCTACTGGAACGCTCCG
AGTGTCTTGTCTATACAGGCCGTGGACCGGTTGATGAACCTCTTCGTTGCCCGCCAAGACAACTATTGCCTCCAG
CTTGCCGTCCTCTTTACCCTGACCTGGCTCGTCATTGCCGTCCTTTCCACCTTGCAAGCCGTCCTCGCCTTGGCC
ATGGAGATTGCCGCCAAATGGCTTCTCCTCGGACGACGACAGCCGGGCAATTATGACTGGGATAAGTCGTCTTAC
TGTCAGAGGTGGCAGCTGCTGATTTGTGTCGACCACATATTACGCCAATGCTACCTCGGTCACGGCATCATCGGC
ATGCTGACGGGAACCAGCTGGATCGTTTTATACTATCGAGCTCTCGGCGCCAAGATGGGCAAGGATTGCGCTCTG
TTTGCCAACGGTCGCCCGAGCTTACTGTTTACGGAGCCTGATCTGATTACCATGGGTGATCGCGTCGCCATCGAC
GACGCCAGTGTTGTGGCTCATATTAATACCCGCGGCAAGTTCGACCTGAACAGGCTGGAGATTGAAAGCGGCTGC
GTCCTGCGCTCCGGCAGCAGGCTGCTGAGCGGAGCCGTTATGAAGAAGGATAGCTGCCTCCTGGAACATACCATG
ATTATGAGCGGTGATGTCGTCAACGAGGGATGGACAATGCAGGGCTGGCCGGCGGACAAGTTTGTCGGCCGACGA
GTGCATGTCGGCGTTGGGAAAGGACGAAAGGCTCATCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail