Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7903
Gene name
Locationscaffold_814:3045..6427
Strand-
Gene length (bp)3382
Transcript length (bp)3318
Coding sequence length (bp)3315
Protein length (aa) 1105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07819 PGAP1 PGAP1-like protein 8.9E-92 168 411
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.4E-06 173 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 3 1105 0.0E+00
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 93 1104 0.0E+00
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 58 1098 0.0E+00
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 42 1087 0.0E+00
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 58 1084 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 3 1105 0.0E+00
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 93 1104 0.0E+00
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 58 1098 0.0E+00
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 42 1087 0.0E+00
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 58 1084 0.0E+00
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 93 1076 0.0E+00
sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 3 1088 0.0E+00
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 93 1085 0.0E+00
sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 86 1079 7.0E-176
sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 123 1077 5.0E-159
sp|Q752Q2|BST1_ASHGO GPI inositol-deacylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BST1 PE=3 SV=2 102 1074 3.0E-147
sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BST1 PE=3 SV=1 121 1075 6.0E-143
sp|P43571|BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BST1 PE=1 SV=1 120 1077 3.0E-139
sp|Q6FLY9|BST1_CANGA GPI inositol-deacylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BST1 PE=3 SV=1 96 1075 2.0E-123
sp|Q6C2Z2|BST1A_YARLI GPI inositol-deacylase A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1A PE=3 SV=1 215 1067 1.0E-100
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 103 428 2.0E-79
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 144 435 5.0E-71
sp|P0CM50|BST1_CRYNJ GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BST1 PE=3 SV=1 126 445 1.0E-56
sp|P0CM51|BST1_CRYNB GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BST1 PE=3 SV=1 126 445 1.0E-56
sp|Q4P782|BST1_USTMA GPI inositol-deacylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BST1 PE=3 SV=1 83 422 9.0E-54
sp|Q765A7|PGAP1_RAT GPI inositol-deacylase OS=Rattus norvegicus GN=Pgap1 PE=1 SV=1 98 436 2.0E-48
sp|Q3UUQ7|PGAP1_MOUSE GPI inositol-deacylase OS=Mus musculus GN=Pgap1 PE=1 SV=3 98 436 4.0E-48
sp|Q75T13|PGAP1_HUMAN GPI inositol-deacylase OS=Homo sapiens GN=PGAP1 PE=1 SV=1 98 436 7.0E-48
sp|Q66J01|PGAP1_XENLA GPI inositol-deacylase OS=Xenopus laevis GN=pgap1 PE=2 SV=1 123 462 2.0E-43
sp|Q59VP0|BST1_CANAL GPI inositol-deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BST1 PE=3 SV=1 98 435 6.0E-43
sp|Q9W495|PGAP1_DROME GPI inositol-deacylase OS=Drosophila melanogaster GN=CG3160 PE=1 SV=3 122 415 2.0E-33
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 642 1073 2.0E-31
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 682 1073 6.0E-23
sp|Q4P782|BST1_USTMA GPI inositol-deacylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BST1 PE=3 SV=1 704 1076 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 801 823 22
3 853 875 22
4 927 949 22
5 970 992 22
6 1007 1029 22
7 1041 1063 22
8 1067 1089 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 61.24 31.76 90.71
CcL In ants, during behavior modification 85.60 41.59 129.60
CcD In ants, recently dead 53.63 28.54 78.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.186228 no
SC16a CcD 0.626157 no
CcL CcD 0.048206 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7903
MTSCSSASTDDGDDSFQPDAINNLNNVRNQINQPELKPRTESTHLNHWVRSHVHNGHASTALAQYSPVAPPAAMP
FGRIAPSSTPTRSRQCSWAASPLVVFIASLGLALLFVIVRSLLRHGVEPKGCRMSYMRPSYLHFPDFDTEHTRFA
TKYSLYLYREQGLDDDKLHGIPVLFIPGNAGSYKQVRPIAAEAANHFYNSLRYDGTSMLAGVRNLDFFTVDFNED
ITAFHGQTLLDQAEYLNEAVRYILSLYTDPQRAERDSRTPDPSAVVILGHSMGGVVARAMLIQPNYQPKSINSII
TMSAPHARPPVTFDAQIVHIYDEINGYWRNAYAQRWANDNPLWHVTLVSIAGGSLDTVVPSDYASLESIVPETHG
FTVFTSGIPTVWTSMDHQAILWCDQFRKVVARALYDIVDVGRASQTKPRADRMRLLKKWFLPGMESAAEKIAAFG
AASTLLTLGHDSSQFVSAGTRLSLGSSTKKSTTVAYLIPIPPPGLPNDNRFTLITDAALNENPAKGGLQVLLCSL
YTHNLDSADASFSTHIDLSGGSTSPTRLACKNSALDTVFLPAYPLDSDPEDGQPHPYTYLQYGQEHLADHQFIAV
VVRSPSLPFGFVLAEFSDSRDFRKHYDTTLSQLLTLGLTLDLPADRPVVVDVSIRSVASALLAFNLEIGQPRCSG
EQKMALLMRQYLNKPYESKYFINARQVSVSLHGTAPFVPPPLEPAREAGLALQFWSDPVCDSPLTVRLKLDVWGS
LGKLYMRYRTILAAFPLLVEAMVLRKQFRVYDETGVFPSFSQSLDQSLRRSVPLLLICLTLLSSSVGASSLFGPF
WRRLDASQLSPGGGGFHRNELLVGTEDFLFCLLIPLIGMVCVGVCTTLHCAMVCFTRSLGLLFGFFSCDAEADQQ
RRTSSITLVPSTSRRRMLFSAALLFLVSTFIPYQFAYVVACLVQVFTVVRALRTSTNVVSADNQNFYHYVHSILL
LMMWVLPINLPILAVWVRNLAVHWLTPFSSHHNVLSIIPFILLVENLTTGSMVPQMTSWLRHVTNLLLFGTAFCV
AIYGVSHAYALHYLVNAVAAWLVFLHSTANAWSLLGLFTTFGKYAGSSRKWGKSP
Coding >Ophio5|7903
ATGACAAGCTGCTCGTCTGCGTCGACTGATGACGGTGACGACTCCTTCCAGCCCGATGCTATCAACAATTTGAAC
AACGTCCGCAATCAAATCAATCAACCGGAATTGAAGCCGCGAACCGAGAGCACACATCTTAACCATTGGGTTCGC
AGCCATGTTCACAATGGTCACGCTTCAACAGCCTTGGCACAGTACTCCCCGGTAGCACCGCCTGCTGCCATGCCT
TTCGGAAGGATCGCTCCTTCGTCTACTCCTACTAGGTCTAGGCAGTGCTCTTGGGCTGCCAGTCCCCTGGTCGTC
TTCATTGCCAGCCTCGGATTGGCGCTTCTCTTTGTCATTGTCAGGTCCCTCCTGCGACACGGGGTTGAACCTAAA
GGCTGTCGCATGTCCTACATGAGGCCTTCCTACCTCCATTTTCCCGACTTTGACACCGAGCACACTCGATTCGCG
ACAAAATACTCACTTTACCTCTACCGCGAACAGGGGCTTGATGACGACAAGTTGCATGGCATTCCGGTCCTTTTC
ATACCTGGAAATGCCGGAAGCTATAAGCAGGTTCGGCCAATTGCGGCCGAGGCTGCCAATCATTTCTACAACAGC
TTGCGCTACGATGGCACCTCAATGCTAGCCGGGGTTCGGAATCTCGATTTCTTCACCGTCGACTTCAACGAGGAC
ATCACCGCTTTTCACGGCCAGACGCTTCTCGATCAAGCCGAGTATCTCAACGAGGCTGTCCGCTATATTCTGTCG
CTGTACACCGATCCTCAACGAGCCGAACGTGATAGTCGGACCCCTGATCCTTCGGCTGTTGTTATACTTGGCCAT
TCCATGGGTGGCGTCGTCGCCCGCGCAATGTTGATCCAGCCCAATTATCAGCCCAAGTCCATCAACTCGATTATA
ACCATGTCTGCGCCACATGCCCGTCCGCCAGTTACCTTCGATGCCCAGATTGTACATATCTATGACGAGATCAAC
GGTTACTGGCGGAACGCCTACGCGCAGAGGTGGGCGAATGATAACCCGTTGTGGCATGTTACCCTTGTGTCCATT
GCCGGCGGCAGTCTTGACACTGTCGTGCCCTCGGACTACGCCAGCCTTGAATCCATTGTACCGGAGACCCACGGC
TTTACTGTCTTCACTTCCGGCATACCAACTGTTTGGACGAGCATGGACCACCAAGCCATCCTCTGGTGTGACCAG
TTCCGCAAGGTGGTGGCTCGTGCACTGTACGACATAGTCGACGTTGGTCGGGCTTCTCAGACCAAGCCCAGAGCC
GATAGGATGCGACTCCTGAAAAAATGGTTTCTACCAGGCATGGAATCTGCCGCGGAGAAGATAGCTGCCTTTGGA
GCCGCTTCAACGCTACTGACTTTGGGCCATGATTCCAGTCAATTTGTCTCAGCTGGAACCAGACTCTCTCTTGGC
AGCTCGACAAAGAAGTCAACAACCGTGGCATACCTAATACCCATCCCGCCGCCGGGCTTGCCCAACGATAACCGC
TTTACTCTCATTACCGATGCAGCTCTAAACGAAAACCCAGCCAAGGGGGGTCTCCAAGTCCTTCTCTGTAGCCTT
TATACACATAACCTCGACTCAGCTGACGCTTCGTTCTCGACGCACATCGACCTATCGGGCGGAAGCACCTCACCA
ACACGATTAGCATGCAAGAATTCTGCGTTGGATACTGTCTTCTTGCCTGCATATCCTCTCGACTCCGACCCAGAA
GATGGACAACCCCACCCTTATACGTATTTGCAGTACGGACAGGAACATCTTGCAGACCATCAATTTATTGCAGTC
GTCGTCCGCTCGCCGTCACTGCCGTTTGGCTTTGTCCTTGCCGAGTTCAGTGATTCGCGAGACTTCAGGAAACAT
TACGACACGACTCTTTCTCAGCTTTTGACTCTAGGTCTAACTTTGGACCTACCTGCTGACCGGCCCGTCGTAGTG
GACGTCAGCATACGCTCCGTCGCTTCGGCTTTGCTTGCATTCAACTTGGAAATCGGCCAACCACGGTGTTCTGGG
GAGCAGAAGATGGCGTTGCTGATGCGGCAGTATCTAAACAAGCCTTACGAGTCAAAATATTTCATCAATGCCAGA
CAAGTCAGCGTCAGTCTTCATGGAACAGCTCCTTTCGTCCCGCCGCCCCTGGAACCAGCGAGGGAAGCCGGACTT
GCACTTCAATTCTGGTCTGACCCGGTATGTGATTCGCCGCTCACAGTGCGGCTGAAGCTGGATGTTTGGGGGAGC
TTGGGCAAGCTTTACATGCGCTACCGAACTATTCTCGCCGCCTTTCCTCTGCTTGTGGAGGCCATGGTTCTCCGA
AAGCAGTTCCGCGTATACGACGAGACCGGCGTTTTCCCCTCATTTTCTCAGAGCCTGGACCAGTCGCTCCGGCGA
TCCGTCCCCTTATTGCTGATCTGCCTCACCCTGCTTTCCTCCTCTGTCGGAGCCTCATCCCTCTTCGGGCCATTC
TGGAGACGGTTGGACGCGAGTCAGCTCTCGCCCGGCGGTGGTGGGTTCCACCGAAACGAGCTGCTCGTTGGAACC
GAGGACTTTCTATTCTGCTTGCTGATTCCACTGATTGGCATGGTTTGCGTCGGAGTCTGCACAACTCTCCACTGT
GCCATGGTCTGTTTCACACGATCGCTCGGCCTGTTGTTCGGCTTCTTCAGTTGCGACGCGGAGGCTGACCAACAA
CGTCGAACGTCGTCGATCACTCTGGTGCCCTCTACGTCCCGGAGAAGGATGCTATTCAGTGCCGCGTTGCTGTTC
CTCGTGTCGACCTTCATTCCGTATCAGTTTGCCTACGTGGTGGCCTGTCTCGTCCAGGTCTTTACCGTCGTCCGT
GCTCTTCGGACCAGCACCAATGTGGTGTCGGCTGACAACCAGAACTTCTACCACTACGTACATTCGATCCTCCTC
CTCATGATGTGGGTTCTTCCCATCAACCTACCGATTCTTGCCGTTTGGGTGCGCAATCTCGCCGTGCATTGGCTC
ACACCGTTTTCCTCTCATCACAACGTCCTCTCCATCATTCCCTTCATCCTGCTGGTGGAAAACCTCACTACTGGC
AGCATGGTGCCGCAAATGACGAGCTGGCTGCGCCACGTCACGAATCTTCTCCTTTTCGGGACTGCCTTCTGCGTT
GCCATCTACGGTGTTTCGCACGCCTATGCCCTCCACTATCTGGTCAATGCCGTGGCTGCGTGGCTCGTCTTCCTC
CACTCGACGGCAAACGCCTGGTCATTGCTCGGCCTGTTCACCACGTTTGGTAAATACGCTGGCAGTTCACGGAAA
TGGGGCAAGAGTCCA
Transcript >Ophio5|7903
ATGACAAGCTGCTCGTCTGCGTCGACTGATGACGGTGACGACTCCTTCCAGCCCGATGCTATCAACAATTTGAAC
AACGTCCGCAATCAAATCAATCAACCGGAATTGAAGCCGCGAACCGAGAGCACACATCTTAACCATTGGGTTCGC
AGCCATGTTCACAATGGTCACGCTTCAACAGCCTTGGCACAGTACTCCCCGGTAGCACCGCCTGCTGCCATGCCT
TTCGGAAGGATCGCTCCTTCGTCTACTCCTACTAGGTCTAGGCAGTGCTCTTGGGCTGCCAGTCCCCTGGTCGTC
TTCATTGCCAGCCTCGGATTGGCGCTTCTCTTTGTCATTGTCAGGTCCCTCCTGCGACACGGGGTTGAACCTAAA
GGCTGTCGCATGTCCTACATGAGGCCTTCCTACCTCCATTTTCCCGACTTTGACACCGAGCACACTCGATTCGCG
ACAAAATACTCACTTTACCTCTACCGCGAACAGGGGCTTGATGACGACAAGTTGCATGGCATTCCGGTCCTTTTC
ATACCTGGAAATGCCGGAAGCTATAAGCAGGTTCGGCCAATTGCGGCCGAGGCTGCCAATCATTTCTACAACAGC
TTGCGCTACGATGGCACCTCAATGCTAGCCGGGGTTCGGAATCTCGATTTCTTCACCGTCGACTTCAACGAGGAC
ATCACCGCTTTTCACGGCCAGACGCTTCTCGATCAAGCCGAGTATCTCAACGAGGCTGTCCGCTATATTCTGTCG
CTGTACACCGATCCTCAACGAGCCGAACGTGATAGTCGGACCCCTGATCCTTCGGCTGTTGTTATACTTGGCCAT
TCCATGGGTGGCGTCGTCGCCCGCGCAATGTTGATCCAGCCCAATTATCAGCCCAAGTCCATCAACTCGATTATA
ACCATGTCTGCGCCACATGCCCGTCCGCCAGTTACCTTCGATGCCCAGATTGTACATATCTATGACGAGATCAAC
GGTTACTGGCGGAACGCCTACGCGCAGAGGTGGGCGAATGATAACCCGTTGTGGCATGTTACCCTTGTGTCCATT
GCCGGCGGCAGTCTTGACACTGTCGTGCCCTCGGACTACGCCAGCCTTGAATCCATTGTACCGGAGACCCACGGC
TTTACTGTCTTCACTTCCGGCATACCAACTGTTTGGACGAGCATGGACCACCAAGCCATCCTCTGGTGTGACCAG
TTCCGCAAGGTGGTGGCTCGTGCACTGTACGACATAGTCGACGTTGGTCGGGCTTCTCAGACCAAGCCCAGAGCC
GATAGGATGCGACTCCTGAAAAAATGGTTTCTACCAGGCATGGAATCTGCCGCGGAGAAGATAGCTGCCTTTGGA
GCCGCTTCAACGCTACTGACTTTGGGCCATGATTCCAGTCAATTTGTCTCAGCTGGAACCAGACTCTCTCTTGGC
AGCTCGACAAAGAAGTCAACAACCGTGGCATACCTAATACCCATCCCGCCGCCGGGCTTGCCCAACGATAACCGC
TTTACTCTCATTACCGATGCAGCTCTAAACGAAAACCCAGCCAAGGGGGGTCTCCAAGTCCTTCTCTGTAGCCTT
TATACACATAACCTCGACTCAGCTGACGCTTCGTTCTCGACGCACATCGACCTATCGGGCGGAAGCACCTCACCA
ACACGATTAGCATGCAAGAATTCTGCGTTGGATACTGTCTTCTTGCCTGCATATCCTCTCGACTCCGACCCAGAA
GATGGACAACCCCACCCTTATACGTATTTGCAGTACGGACAGGAACATCTTGCAGACCATCAATTTATTGCAGTC
GTCGTCCGCTCGCCGTCACTGCCGTTTGGCTTTGTCCTTGCCGAGTTCAGTGATTCGCGAGACTTCAGGAAACAT
TACGACACGACTCTTTCTCAGCTTTTGACTCTAGGTCTAACTTTGGACCTACCTGCTGACCGGCCCGTCGTAGTG
GACGTCAGCATACGCTCCGTCGCTTCGGCTTTGCTTGCATTCAACTTGGAAATCGGCCAACCACGGTGTTCTGGG
GAGCAGAAGATGGCGTTGCTGATGCGGCAGTATCTAAACAAGCCTTACGAGTCAAAATATTTCATCAATGCCAGA
CAAGTCAGCGTCAGTCTTCATGGAACAGCTCCTTTCGTCCCGCCGCCCCTGGAACCAGCGAGGGAAGCCGGACTT
GCACTTCAATTCTGGTCTGACCCGGTATGTGATTCGCCGCTCACAGTGCGGCTGAAGCTGGATGTTTGGGGGAGC
TTGGGCAAGCTTTACATGCGCTACCGAACTATTCTCGCCGCCTTTCCTCTGCTTGTGGAGGCCATGGTTCTCCGA
AAGCAGTTCCGCGTATACGACGAGACCGGCGTTTTCCCCTCATTTTCTCAGAGCCTGGACCAGTCGCTCCGGCGA
TCCGTCCCCTTATTGCTGATCTGCCTCACCCTGCTTTCCTCCTCTGTCGGAGCCTCATCCCTCTTCGGGCCATTC
TGGAGACGGTTGGACGCGAGTCAGCTCTCGCCCGGCGGTGGTGGGTTCCACCGAAACGAGCTGCTCGTTGGAACC
GAGGACTTTCTATTCTGCTTGCTGATTCCACTGATTGGCATGGTTTGCGTCGGAGTCTGCACAACTCTCCACTGT
GCCATGGTCTGTTTCACACGATCGCTCGGCCTGTTGTTCGGCTTCTTCAGTTGCGACGCGGAGGCTGACCAACAA
CGTCGAACGTCGTCGATCACTCTGGTGCCCTCTACGTCCCGGAGAAGGATGCTATTCAGTGCCGCGTTGCTGTTC
CTCGTGTCGACCTTCATTCCGTATCAGTTTGCCTACGTGGTGGCCTGTCTCGTCCAGGTCTTTACCGTCGTCCGT
GCTCTTCGGACCAGCACCAATGTGGTGTCGGCTGACAACCAGAACTTCTACCACTACGTACATTCGATCCTCCTC
CTCATGATGTGGGTTCTTCCCATCAACCTACCGATTCTTGCCGTTTGGGTGCGCAATCTCGCCGTGCATTGGCTC
ACACCGTTTTCCTCTCATCACAACGTCCTCTCCATCATTCCCTTCATCCTGCTGGTGGAAAACCTCACTACTGGC
AGCATGGTGCCGCAAATGACGAGCTGGCTGCGCCACGTCACGAATCTTCTCCTTTTCGGGACTGCCTTCTGCGTT
GCCATCTACGGTGTTTCGCACGCCTATGCCCTCCACTATCTGGTCAATGCCGTGGCTGCGTGGCTCGTCTTCCTC
CACTCGACGGCAAACGCCTGGTCATTGCTCGGCCTGTTCACCACGTTTGGTAAATACGCTGGCAGTTCACGGAAA
TGGGGCAAGAGTCCATGA
Gene >Ophio5|7903
ATGACAAGCTGCTCGTCTGCGTCGACTGATGACGGTGACGACTCCTTCCAGCCCGATGCTATCAACAATTTGAAC
AACGTCCGCAATCAAATCAATCAACCGGAATTGAAGCCGCGAACCGAGAGCACACATCTTAACCATTGGGTTCGC
AGCCATGTTCACAATGGTCACGCTTCAACAGCCTTGGCACAGTACTCCCCGGTAGCACCGCCTGCTGCCATGCCT
TTCGGAAGGATCGCTCCTTCGTCTACTCCTACTAGGTCTAGGCAGTGCTCTTGGGCTGCCAGTCCCCTGGTCGTC
TTCATTGCCAGCCTCGGATTGGCGCTTCTCTTTGTCATTGTCAGGTCCCTCCTGCGACACGGGGTTGAACCTAAA
GGCTGTCGCATGTCCTACATGAGGCCTTCCTACCTCCATTTTCCCGACTTTGACACCGAGCACACTCGATTCGCG
ACAAAATACTCACTTTACCTCTACCGCGAACAGGGGCTTGATGACGACAAGGTGTGTCATATATAAATCCTGTTT
CTCTCCTCGGGTGACCCCGATGGATGTTAATCTCGTCTAGTTGCATGGCATTCCGGTCCTTTTCATACCTGGAAA
TGCCGGAAGCTATAAGCAGGTTCGGCCAATTGCGGCCGAGGCTGCCAATCATTTCTACAACAGCTTGCGCTACGA
TGGCACCTCAATGCTAGCCGGGGTTCGGAATCTCGATTTCTTCACCGTCGACTTCAACGAGGACATCACCGCTTT
TCACGGCCAGACGCTTCTCGATCAAGCCGAGTATCTCAACGAGGCTGTCCGCTATATTCTGTCGCTGTACACCGA
TCCTCAACGAGCCGAACGTGATAGTCGGACCCCTGATCCTTCGGCTGTTGTTATACTTGGCCATTCCATGGGTGG
CGTCGTCGCCCGCGCAATGTTGATCCAGCCCAATTATCAGCCCAAGTCCATCAACTCGATTATAACCATGTCTGC
GCCACATGCCCGTCCGCCAGTTACCTTCGATGCCCAGATTGTACATATCTATGACGAGATCAACGGTTACTGGCG
GAACGCCTACGCGCAGAGGTGGGCGAATGATAACCCGTTGTGGCATGTTACCCTTGTGTCCATTGCCGGCGGCAG
TCTTGACACTGTCGTGCCCTCGGACTACGCCAGCCTTGAATCCATTGTACCGGAGACCCACGGCTTTACTGTCTT
CACTTCCGGCATACCAACTGTTTGGACGAGCATGGACCACCAAGCCATCCTCTGGTGTGACCAGTTCCGCAAGGT
GGTGGCTCGTGCACTGTACGACATAGTCGACGTTGGTCGGGCTTCTCAGACCAAGCCCAGAGCCGATAGGATGCG
ACTCCTGAAAAAATGGTTTCTACCAGGCATGGAATCTGCCGCGGAGAAGATAGCTGCCTTTGGAGCCGCTTCAAC
GCTACTGACTTTGGGCCATGATTCCAGTCAATTTGTCTCAGCTGGAACCAGACTCTCTCTTGGCAGCTCGACAAA
GAAGTCAACAACCGTGGCATACCTAATACCCATCCCGCCGCCGGGCTTGCCCAACGATAACCGCTTTACTCTCAT
TACCGATGCAGCTCTAAACGAAAACCCAGCCAAGGGGGGTCTCCAAGTCCTTCTCTGTAGCCTTTATACACATAA
CCTCGACTCAGCTGACGCTTCGTTCTCGACGCACATCGACCTATCGGGCGGAAGCACCTCACCAACACGATTAGC
ATGCAAGAATTCTGCGTTGGATACTGTCTTCTTGCCTGCATATCCTCTCGACTCCGACCCAGAAGATGGACAACC
CCACCCTTATACGTATTTGCAGTACGGACAGGAACATCTTGCAGACCATCAATTTATTGCAGTCGTCGTCCGCTC
GCCGTCACTGCCGTTTGGCTTTGTCCTTGCCGAGTTCAGTGATTCGCGAGACTTCAGGAAACATTACGACACGAC
TCTTTCTCAGCTTTTGACTCTAGGTCTAACTTTGGACCTACCTGCTGACCGGCCCGTCGTAGTGGACGTCAGCAT
ACGCTCCGTCGCTTCGGCTTTGCTTGCATTCAACTTGGAAATCGGCCAACCACGGTGTTCTGGGGAGCAGAAGAT
GGCGTTGCTGATGCGGCAGTATCTAAACAAGCCTTACGAGTCAAAATATTTCATCAATGCCAGACAAGTCAGCGT
CAGTCTTCATGGAACAGCTCCTTTCGTCCCGCCGCCCCTGGAACCAGCGAGGGAAGCCGGACTTGCACTTCAATT
CTGGTCTGACCCGGTATGTGATTCGCCGCTCACAGTGCGGCTGAAGCTGGATGTTTGGGGGAGCTTGGGCAAGCT
TTACATGCGCTACCGAACTATTCTCGCCGCCTTTCCTCTGCTTGTGGAGGCCATGGTTCTCCGAAAGCAGTTCCG
CGTATACGACGAGACCGGCGTTTTCCCCTCATTTTCTCAGAGCCTGGACCAGTCGCTCCGGCGATCCGTCCCCTT
ATTGCTGATCTGCCTCACCCTGCTTTCCTCCTCTGTCGGAGCCTCATCCCTCTTCGGGCCATTCTGGAGACGGTT
GGACGCGAGTCAGCTCTCGCCCGGCGGTGGTGGGTTCCACCGAAACGAGCTGCTCGTTGGAACCGAGGACTTTCT
ATTCTGCTTGCTGATTCCACTGATTGGCATGGTTTGCGTCGGAGTCTGCACAACTCTCCACTGTGCCATGGTCTG
TTTCACACGATCGCTCGGCCTGTTGTTCGGCTTCTTCAGTTGCGACGCGGAGGCTGACCAACAACGTCGAACGTC
GTCGATCACTCTGGTGCCCTCTACGTCCCGGAGAAGGATGCTATTCAGTGCCGCGTTGCTGTTCCTCGTGTCGAC
CTTCATTCCGTATCAGTTTGCCTACGTGGTGGCCTGTCTCGTCCAGGTCTTTACCGTCGTCCGTGCTCTTCGGAC
CAGCACCAATGTGGTGTCGGCTGACAACCAGAACTTCTACCACTACGTACATTCGATCCTCCTCCTCATGATGTG
GGTTCTTCCCATCAACCTACCGATTCTTGCCGTTTGGGTGCGCAATCTCGCCGTGCATTGGCTCACACCGTTTTC
CTCTCATCACAACGTCCTCTCCATCATTCCCTTCATCCTGCTGGTGGAAAACCTCACTACTGGCAGCATGGTGCC
GCAAATGACGAGCTGGCTGCGCCACGTCACGAATCTTCTCCTTTTCGGGACTGCCTTCTGCGTTGCCATCTACGG
TGTTTCGCACGCCTATGCCCTCCACTATCTGGTCAATGCCGTGGCTGCGTGGCTCGTCTTCCTCCACTCGACGGC
AAACGCCTGGTCATTGCTCGGCCTGTTCACCACGTTTGGTAAATACGCTGGCAGTTCACGGAAATGGGGCAAGAG
TCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail