Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7882
Gene name
Locationscaffold_81:21555..23486
Strand-
Gene length (bp)1931
Transcript length (bp)1758
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13415 Kelch_3 Galactose oxidase, central domain 5.5E-05 277 323
PF13415 Kelch_3 Galactose oxidase, central domain 2.8E-05 379 432
PF13415 Kelch_3 Galactose oxidase, central domain 1.4E-04 484 532
PF13854 Kelch_5 Kelch motif 5.9E-07 364 399
PF01344 Kelch_1 Kelch motif 3.6E-07 366 404
PF01344 Kelch_1 Kelch motif 1.6E-04 427 466
PF13964 Kelch_6 Kelch motif 4.6E-07 367 411
PF13418 Kelch_4 Galactose oxidase, central domain 8.0E-06 366 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 253 545 2.0E-22
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 262 545 9.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 262 545 1.0E-21
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 268 492 2.0E-21
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 262 545 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 253 545 2.0E-22
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 262 545 9.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 262 545 1.0E-21
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 268 492 2.0E-21
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 262 545 5.0E-21
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 269 542 3.0E-19
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 269 542 7.0E-19
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 269 496 2.0E-18
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 262 585 2.0E-18
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 269 542 9.0E-18
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 313 557 9.0E-18
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 269 542 1.0E-17
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 268 532 3.0E-17
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 268 557 1.0E-16
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 249 461 2.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 352 557 2.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 303 562 3.0E-16
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 258 492 3.0E-16
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 253 542 4.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 235 411 8.0E-16
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 269 513 1.0E-15
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 269 513 1.0E-15
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 269 513 2.0E-15
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 312 542 8.0E-15
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 253 545 1.0E-14
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 268 545 1.0E-14
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 354 562 2.0E-14
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 352 557 2.0E-14
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 268 545 2.0E-14
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 324 578 3.0E-14
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 268 444 3.0E-14
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 235 411 5.0E-14
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 251 407 6.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 273 532 1.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 303 562 2.0E-13
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 325 563 3.0E-13
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 277 483 3.0E-13
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 278 483 3.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 253 512 5.0E-13
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 253 504 7.0E-13
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 320 542 8.0E-13
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 300 513 8.0E-13
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 253 506 1.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 310 543 2.0E-12
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 310 543 2.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 320 542 2.0E-12
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 253 427 2.0E-12
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 349 562 2.0E-12
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 278 483 2.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 310 543 4.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 320 542 4.0E-12
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 263 498 4.0E-12
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 243 550 5.0E-12
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 235 509 5.0E-12
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 268 401 6.0E-12
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 307 557 9.0E-12
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 267 559 1.0E-11
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 277 483 1.0E-11
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 302 543 1.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 243 410 2.0E-11
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 293 505 2.0E-11
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 269 543 2.0E-11
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 273 492 2.0E-11
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 422 572 2.0E-11
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 307 557 2.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 268 494 2.0E-11
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 253 467 3.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 310 546 4.0E-11
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 253 506 4.0E-11
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 253 467 7.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 277 483 7.0E-11
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 438 557 7.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 269 413 9.0E-11
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 268 498 9.0E-11
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 268 544 1.0E-10
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 348 557 2.0E-10
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 353 558 2.0E-10
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 362 558 2.0E-10
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 252 415 2.0E-10
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 268 543 2.0E-10
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 268 542 2.0E-10
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 268 550 2.0E-10
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 268 550 2.0E-10
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 253 467 3.0E-10
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 348 557 3.0E-10
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 348 557 3.0E-10
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 250 545 3.0E-10
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 438 557 3.0E-10
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 301 543 4.0E-10
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 260 490 5.0E-10
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 260 490 5.0E-10
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 253 542 5.0E-10
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 269 492 5.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 248 374 7.0E-10
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 268 573 8.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 424 547 1.0E-09
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 299 492 1.0E-09
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 260 464 1.0E-09
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 268 498 1.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 266 386 2.0E-09
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 299 502 2.0E-09
sp|Q70JS2|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2 278 554 2.0E-09
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 242 451 3.0E-09
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 299 492 3.0E-09
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 268 514 3.0E-09
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 349 557 4.0E-09
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 349 557 4.0E-09
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 253 509 4.0E-09
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 231 517 4.0E-09
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 310 514 4.0E-09
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 349 557 5.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 248 386 5.0E-09
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 299 492 5.0E-09
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 314 512 5.0E-09
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 303 543 6.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 299 542 6.0E-09
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 231 517 6.0E-09
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 231 517 6.0E-09
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 231 517 6.0E-09
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 270 402 7.0E-09
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 264 556 9.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 347 542 1.0E-08
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 243 508 1.0E-08
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 268 514 1.0E-08
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 253 445 2.0E-08
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 362 562 2.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 320 544 2.0E-08
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 370 544 2.0E-08
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 253 507 2.0E-08
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 268 445 3.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 364 495 3.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 268 514 3.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 268 514 3.0E-08
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 269 492 3.0E-08
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 291 492 3.0E-08
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 253 445 4.0E-08
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 253 445 4.0E-08
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 253 481 4.0E-08
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 253 481 4.0E-08
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 268 543 4.0E-08
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 379 573 5.0E-08
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 268 492 5.0E-08
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 253 384 7.0E-08
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 278 539 7.0E-08
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 253 507 7.0E-08
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 353 558 1.0E-07
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 250 575 1.0E-07
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 268 527 2.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 362 562 2.0E-07
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 268 527 3.0E-07
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 250 545 3.0E-07
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 327 543 3.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 250 545 3.0E-07
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 314 512 3.0E-07
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 268 542 4.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 278 512 4.0E-07
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 268 527 7.0E-07
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 275 546 9.0E-07
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 275 554 1.0E-06
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 314 512 1.0E-06
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 275 571 1.0E-06
sp|Q6JEL3|KLH10_RAT Kelch-like protein 10 OS=Rattus norvegicus GN=Klhl10 PE=1 SV=1 278 545 1.0E-06
sp|Q9D5V2|KLH10_MOUSE Kelch-like protein 10 OS=Mus musculus GN=Klhl10 PE=1 SV=1 278 545 1.0E-06
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 250 545 2.0E-06
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 303 573 2.0E-06
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 303 573 2.0E-06
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 306 557 2.0E-06
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 231 518 2.0E-06
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 313 543 2.0E-06
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 275 554 2.0E-06
sp|Q6JEL2|KLH10_HUMAN Kelch-like protein 10 OS=Homo sapiens GN=KLHL10 PE=1 SV=1 278 545 2.0E-06
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 231 467 3.0E-06
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 314 520 3.0E-06
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 275 554 3.0E-06
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 275 571 3.0E-06
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 275 546 4.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 253 386 5.0E-06
sp|Q04652|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4 311 554 5.0E-06
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 314 512 5.0E-06
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 262 566 6.0E-06
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 275 554 9.0E-06
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 307 512 9.0E-06
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=1 SV=1 307 512 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 50.47 27.57 73.36
CcL In ants, during behavior modification 27.02 13.75 40.29
CcD In ants, recently dead 49.27 26.92 71.61

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.003754 yes
SC16a CcD 0.931101 no
CcL CcD 0.007145 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7882
MSPDSAAPADKPSPAMAKAVARSDDKPQPLPRSHTPGHLAGGSPADGRRKTTDLALRRRPQPPSIASAAPKSPPS
SSRVDDGESDDDDGDDDDNDNDNDDEDDDDEDDDDEDDEDEDERQNHKGKQPQRQPQKKSRKHLQRQSQKQAQKQ
AQSRQPPAKATSRSKSLAPAPTPAPIPTPAPAPASAPAPAPVPAPAPASTPAPVPAPASRQTTTATTTRVSRPPR
GPHVPFPPLQDPKDAPDVKPAPASAMYWSKAFTSGSPHHNLRAHTATPVGSNIIVFGGWDSRACFNNVYVLDGDA
FYWSVPHIVGEMPPPLRAMTCTAVGKKLVLFGGGDGPAYYNAVYVLDTLNFRWTRPRILGDDAPCARRAHSACFY
RNGIYVFGGGDGDKALNDIWRLDVADVSKMTWRLISGHDDSEADDAPRPKARGYHTGNMSGSKLIIYGGSDGTEC
FDDVWIYDVERRIWKAVDIPVSFRRLSHTATLVGSYLFVLGGHDGEEYRNDLLLLNLVTMTWDKREAYGKAPSAR
GYHTTVLHDSRLLMIGGFDGTVVYGDVTILELARHAYYPQISQFTIDQQSVCIYILALQK
Coding >Ophio5|7882
ATGTCGCCGGACTCGGCCGCGCCGGCCGACAAGCCGTCACCGGCCATGGCTAAGGCGGTGGCGCGGTCCGACGAC
AAGCCGCAGCCGTTGCCGCGAAGCCATACGCCAGGCCATCTGGCCGGCGGCAGCCCGGCCGACGGTCGTCGAAAG
ACAACAGACCTTGCCCTTCGCCGCCGTCCACAGCCGCCTTCTATCGCCTCCGCTGCCCCGAAGTCACCGCCCAGC
TCGAGCAGAGTCGACGATGGCGAGAGCGACGATGACGATGGTGACGACGATGACAATGACAATGACAATGACGAT
GAAGACGATGACGATGAAGACGATGACGATGAAGACGACGAGGATGAAGACGAGCGCCAAAATCACAAGGGGAAG
CAGCCTCAGAGGCAGCCCCAGAAGAAGTCCCGGAAACATCTCCAGAGGCAGTCCCAGAAGCAGGCCCAAAAGCAG
GCCCAGTCGCGGCAGCCTCCCGCAAAGGCCACCAGCCGCAGCAAGTCGTTGGCCCCAGCTCCGACTCCCGCTCCG
ATCCCGACCCCAGCTCCGGCTCCGGCTTCAGCTCCAGCTCCAGCTCCGGTCCCGGCGCCAGCTCCGGCCTCGACT
CCGGCTCCGGTTCCAGCTCCGGCTTCGCGACAGACGACGACAGCCACAACCACACGCGTCAGCCGTCCGCCGCGC
GGGCCGCACGTTCCCTTTCCTCCGCTCCAAGACCCCAAGGATGCGCCCGACGTGAAGCCGGCGCCGGCATCGGCC
ATGTACTGGTCCAAAGCCTTCACCAGCGGCTCACCACACCACAACCTACGAGCGCACACGGCGACGCCCGTTGGC
TCCAACATCATCGTCTTCGGAGGATGGGACTCGCGAGCATGCTTCAACAACGTCTACGTCCTTGACGGCGACGCC
TTTTACTGGTCCGTGCCGCACATCGTCGGCGAGATGCCACCGCCGCTACGGGCCATGACATGCACAGCCGTCGGC
AAGAAGCTCGTTCTCTTCGGCGGCGGCGACGGGCCGGCCTATTACAACGCCGTCTACGTCCTCGACACGCTCAAC
TTTCGCTGGACGAGGCCGCGCATCCTCGGTGACGATGCGCCGTGCGCGCGCCGTGCTCACTCGGCTTGCTTCTAC
CGCAATGGCATATACGTGTTTGGCGGAGGCGACGGCGACAAGGCTCTCAACGACATTTGGCGCCTCGACGTCGCT
GACGTCTCCAAGATGACCTGGAGGCTGATATCGGGCCACGACGACAGCGAGGCAGACGACGCTCCCCGACCAAAG
GCCCGCGGCTATCACACCGGCAACATGAGCGGCAGCAAGCTCATCATCTACGGCGGCTCCGACGGCACCGAATGC
TTCGACGACGTCTGGATCTACGATGTCGAAAGGCGCATCTGGAAGGCCGTCGACATTCCCGTCTCCTTTCGCCGC
CTGTCGCACACTGCAACCCTGGTCGGCTCCTATCTCTTCGTCCTAGGCGGCCACGACGGCGAAGAGTACCGCAAC
GACTTGCTACTGCTCAACCTCGTCACCATGACCTGGGATAAGCGCGAAGCCTACGGCAAGGCCCCTTCCGCCCGT
GGCTATCACACCACCGTACTGCACGACAGCAGGCTGCTGATGATCGGCGGCTTTGACGGCACCGTCGTCTACGGA
GACGTCACAATTCTCGAGCTGGCAAGGCACGCCTACTATCCGCAGATCAGCCAGTTTACCATTGACCAACAGTCT
GTCTGTATATACATACTCGCTCTTCAAAAG
Transcript >Ophio5|7882
ATGTCGCCGGACTCGGCCGCGCCGGCCGACAAGCCGTCACCGGCCATGGCTAAGGCGGTGGCGCGGTCCGACGAC
AAGCCGCAGCCGTTGCCGCGAAGCCATACGCCAGGCCATCTGGCCGGCGGCAGCCCGGCCGACGGTCGTCGAAAG
ACAACAGACCTTGCCCTTCGCCGCCGTCCACAGCCGCCTTCTATCGCCTCCGCTGCCCCGAAGTCACCGCCCAGC
TCGAGCAGAGTCGACGATGGCGAGAGCGACGATGACGATGGTGACGACGATGACAATGACAATGACAATGACGAT
GAAGACGATGACGATGAAGACGATGACGATGAAGACGACGAGGATGAAGACGAGCGCCAAAATCACAAGGGGAAG
CAGCCTCAGAGGCAGCCCCAGAAGAAGTCCCGGAAACATCTCCAGAGGCAGTCCCAGAAGCAGGCCCAAAAGCAG
GCCCAGTCGCGGCAGCCTCCCGCAAAGGCCACCAGCCGCAGCAAGTCGTTGGCCCCAGCTCCGACTCCCGCTCCG
ATCCCGACCCCAGCTCCGGCTCCGGCTTCAGCTCCAGCTCCAGCTCCGGTCCCGGCGCCAGCTCCGGCCTCGACT
CCGGCTCCGGTTCCAGCTCCGGCTTCGCGACAGACGACGACAGCCACAACCACACGCGTCAGCCGTCCGCCGCGC
GGGCCGCACGTTCCCTTTCCTCCGCTCCAAGACCCCAAGGATGCGCCCGACGTGAAGCCGGCGCCGGCATCGGCC
ATGTACTGGTCCAAAGCCTTCACCAGCGGCTCACCACACCACAACCTACGAGCGCACACGGCGACGCCCGTTGGC
TCCAACATCATCGTCTTCGGAGGATGGGACTCGCGAGCATGCTTCAACAACGTCTACGTCCTTGACGGCGACGCC
TTTTACTGGTCCGTGCCGCACATCGTCGGCGAGATGCCACCGCCGCTACGGGCCATGACATGCACAGCCGTCGGC
AAGAAGCTCGTTCTCTTCGGCGGCGGCGACGGGCCGGCCTATTACAACGCCGTCTACGTCCTCGACACGCTCAAC
TTTCGCTGGACGAGGCCGCGCATCCTCGGTGACGATGCGCCGTGCGCGCGCCGTGCTCACTCGGCTTGCTTCTAC
CGCAATGGCATATACGTGTTTGGCGGAGGCGACGGCGACAAGGCTCTCAACGACATTTGGCGCCTCGACGTCGCT
GACGTCTCCAAGATGACCTGGAGGCTGATATCGGGCCACGACGACAGCGAGGCAGACGACGCTCCCCGACCAAAG
GCCCGCGGCTATCACACCGGCAACATGAGCGGCAGCAAGCTCATCATCTACGGCGGCTCCGACGGCACCGAATGC
TTCGACGACGTCTGGATCTACGATGTCGAAAGGCGCATCTGGAAGGCCGTCGACATTCCCGTCTCCTTTCGCCGC
CTGTCGCACACTGCAACCCTGGTCGGCTCCTATCTCTTCGTCCTAGGCGGCCACGACGGCGAAGAGTACCGCAAC
GACTTGCTACTGCTCAACCTCGTCACCATGACCTGGGATAAGCGCGAAGCCTACGGCAAGGCCCCTTCCGCCCGT
GGCTATCACACCACCGTACTGCACGACAGCAGGCTGCTGATGATCGGCGGCTTTGACGGCACCGTCGTCTACGGA
GACGTCACAATTCTCGAGCTGGCAAGGCACGCCTACTATCCGCAGATCAGCCAGTTTACCATTGACCAACAGTCT
GTCTGTATATACATACTCGCTCTTCAAAAGTGA
Gene >Ophio5|7882
ATGTCGCCGGACTCGGCCGCGCCGGCCGACAAGCCGTCACCGGCCATGGCTAAGGCGGTGGCGCGGTCCGACGAC
AAGCCGCAGCCGTTGCCGCGAAGCCATACGCCAGGCCATCTGGCCGGCGGCAGCCCGGCCGACGGTCGTCGAAAG
ACAACAGACCTTGCCCTTCGCCGCCGTCCACAGCCGCCTTCTATCGCCTCCGCTGCCCCGAAGTCACCGCCCAGC
TCGAGCAGAGTCGACGATGGCGAGAGCGACGATGACGATGGTGACGACGATGACAATGACAATGACAATGACGAT
GAAGACGATGACGATGAAGACGATGACGATGAAGACGACGAGGATGAAGACGAGCGCCAAAATCACAAGGGGAAG
CAGCCTCAGAGGCAGCCCCAGAAGAAGTCCCGGAAACATCTCCAGAGGCAGTCCCAGAAGCAGGCCCAAAAGCAG
GCCCAGTCGCGGCAGCCTCCCGCAAAGGCCACCAGCCGCAGCAAGTCGTTGGCCCCAGCTCCGACTCCCGCTCCG
ATCCCGACCCCAGCTCCGGCTCCGGCTTCAGCTCCAGCTCCAGCTCCGGTCCCGGCGCCAGCTCCGGCCTCGACT
CCGGCTCCGGTTCCAGCTCCGGCTTCGCGACAGACGACGACAGCCACAACCACACGCGTCAGCCGTCCGCCGCGC
GGGCCGCACGTTCCCTTTCCTCCGCTCCAAGACCCCAAGGATGCGCCCGACGTGAAGCCGGCGCCGGCATCGGCC
ATGTACTGGTCCAAAGCCTTCACCAGCGGCTCACCACACCACAACCTACGAGCGCACACGGCGACGCCCGTTGGC
TCCAACATCATCGTCTTCGGAGGATGGGACTCGCGAGCATGCTTCAACAACGTCTACGTCCTTGACGGCGACGCC
TTTTACTGGTCCGTGCCGCACATCGTCGGCGAGATGCCACCGCCGCTACGGGCCATGACATGCACAGCCGTCGGC
AAGAAGCTCGTTCTCTTCGGCGGCGGCGACGGGCCGGCCTATTACAACGCCGTCTACGTCCTCGACACGCTCAAC
TTTCGCTGGACGAGGCCGCGCATCCTCGGTGACGATGCGCCGTGCGCGCGCCGTGCTCACTCGGCTTGCTTCTAC
CGCAATGGCATATACGTGTTTGGCGGAGGCGACGGCGACAAGGCTCTCAACGACATTTGGCGCCTCGACGTCGCT
GACGTCTCCAAGATGACCTGGAGGCTGATATCGGGCCACGACGACAGCGAGGCAGACGACGCTCCCCGACCAAAG
GCCCGCGGCTATCACACCGGCAACATGAGCGGCAGCAAGCTCATCATCTACGGCGGCTCCGACGGCACCGAATGC
TTCGACGACGTCTGGATCTACGATGTCGAAAGGCGCATCTGGAAGGCCGTCGACATTCCCGTCTCCTTTCGCCGC
CTGTCGCACACTGCAACCCTGGTCGGCTCCTATCTCTTCGTCCTAGGCGGCCACGACGGCGAAGAGTACCGCAAC
GACTTGCTACTGCTCAACCTCGTCACCATGACCTGGGATAAGCGCGAAGCCTACGGCAAGGCCCCTTCCGCCCGT
GGCTATCACACCACCGTACTGCACGACAGCAGGCTGCTGATGATCGGCGGCTTTGACGGCACCGTCGTCTACGGA
GACGTCACAATTCTCGAGCTGGCAAGGCACGCCTACTATCCGCAGATCAGCCAGTTTACCATTGACGTATGAAGA
CGCGGCTCAGAGCTTAATGGAAAGCGGAACGCGTCGGCCGAGGAAGGGGAGTTGCACCAGTAGTGAAGCAACAGT
CTGTCTGTATATACATGTAAGCTTTCTTCTTGGTCCATCGGATTTCGACATGGACTTCCATCAACCTTCCGGAAA
GGTTGGTCCCTCTTCCAGTCTAAATTTCGCTGCACAGACTCGCTCTTCAAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail