Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7882
Gene name
Locationscaffold_81:21555..23486
Strand-
Gene length (bp)1931
Transcript length (bp)1758
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13415 Kelch_3 Galactose oxidase, central domain 5.5E-05 277 323
PF13415 Kelch_3 Galactose oxidase, central domain 2.8E-05 379 432
PF13415 Kelch_3 Galactose oxidase, central domain 1.4E-04 484 532
PF13854 Kelch_5 Kelch motif 5.9E-07 364 399
PF01344 Kelch_1 Kelch motif 3.6E-07 366 404
PF01344 Kelch_1 Kelch motif 1.6E-04 427 466
PF13964 Kelch_6 Kelch motif 4.6E-07 367 411
PF13418 Kelch_4 Galactose oxidase, central domain 8.0E-06 366 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 253 545 2.0E-22
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 262 545 9.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 262 545 1.0E-21
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 268 492 2.0E-21
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 262 545 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 253 545 2.0E-22
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 262 545 9.0E-22
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 262 545 1.0E-21
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 268 492 2.0E-21
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 262 545 5.0E-21
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 269 542 3.0E-19
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 269 542 7.0E-19
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 269 496 2.0E-18
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 262 585 2.0E-18
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 269 542 9.0E-18
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 313 557 9.0E-18
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 269 542 1.0E-17
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 268 532 3.0E-17
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 268 557 1.0E-16
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 249 461 2.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 352 557 2.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 303 562 3.0E-16
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 258 492 3.0E-16
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 253 542 4.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 235 411 8.0E-16
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 269 513 1.0E-15
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 269 513 1.0E-15
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 269 513 2.0E-15
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 312 542 8.0E-15
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 253 545 1.0E-14
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 268 545 1.0E-14
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 354 562 2.0E-14
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 352 557 2.0E-14
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 268 545 2.0E-14
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 324 578 3.0E-14
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 268 444 3.0E-14
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 235 411 5.0E-14
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 251 407 6.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 273 532 1.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 303 562 2.0E-13
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 325 563 3.0E-13
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 277 483 3.0E-13
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 278 483 3.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 253 512 5.0E-13
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 253 504 7.0E-13
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 320 542 8.0E-13
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 300 513 8.0E-13
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 253 506 1.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 310 543 2.0E-12
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 310 543 2.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 320 542 2.0E-12
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 253 427 2.0E-12
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 349 562 2.0E-12
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 278 483 2.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 310 543 4.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 320 542 4.0E-12
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 263 498 4.0E-12
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 243 550 5.0E-12
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 235 509 5.0E-12
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 268 401 6.0E-12
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 307 557 9.0E-12
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 267 559 1.0E-11
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 277 483 1.0E-11
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 302 543 1.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 243 410 2.0E-11
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 293 505 2.0E-11
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 269 543 2.0E-11
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 273 492 2.0E-11
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 422 572 2.0E-11
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 307 557 2.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 268 494 2.0E-11
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 253 467 3.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 310 546 4.0E-11
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 253 506 4.0E-11
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 253 467 7.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 277 483 7.0E-11
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 438 557 7.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 269 413 9.0E-11
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 268 498 9.0E-11
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 268 544 1.0E-10
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 348 557 2.0E-10
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 353 558 2.0E-10
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 362 558 2.0E-10
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 252 415 2.0E-10
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 268 543 2.0E-10
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 268 542 2.0E-10
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 268 550 2.0E-10
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 268 550 2.0E-10
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 253 467 3.0E-10
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 348 557 3.0E-10
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 348 557 3.0E-10
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 250 545 3.0E-10
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 438 557 3.0E-10
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 301 543 4.0E-10
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 260 490 5.0E-10
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 260 490 5.0E-10
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 253 542 5.0E-10
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 269 492 5.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 248 374 7.0E-10
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 268 573 8.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 424 547 1.0E-09
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 299 492 1.0E-09
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 260 464 1.0E-09
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 268 498 1.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 266 386 2.0E-09
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 299 502 2.0E-09
sp|Q70JS2|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2 278 554 2.0E-09
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 242 451 3.0E-09
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 299 492 3.0E-09
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 268 514 3.0E-09
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 349 557 4.0E-09
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 349 557 4.0E-09
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 253 509 4.0E-09
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 231 517 4.0E-09
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 310 514 4.0E-09
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 349 557 5.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 248 386 5.0E-09
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 299 492 5.0E-09
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 314 512 5.0E-09
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 303 543 6.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 299 542 6.0E-09
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 231 517 6.0E-09
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 231 517 6.0E-09
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 231 517 6.0E-09
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 270 402 7.0E-09
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 264 556 9.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 347 542 1.0E-08
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 243 508 1.0E-08
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 268 514 1.0E-08
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 253 445 2.0E-08
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 362 562 2.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 320 544 2.0E-08
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 370 544 2.0E-08
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 253 507 2.0E-08
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 268 445 3.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 364 495 3.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 268 514 3.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 268 514 3.0E-08
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 269 492 3.0E-08
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 291 492 3.0E-08
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 253 445 4.0E-08
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 253 445 4.0E-08
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 253 481 4.0E-08
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 253 481 4.0E-08
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 268 543 4.0E-08
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 379 573 5.0E-08
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 268 492 5.0E-08
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 253 384 7.0E-08
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 278 539 7.0E-08
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 253 507 7.0E-08
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 353 558 1.0E-07
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 250 575 1.0E-07
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 268 527 2.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 362 562 2.0E-07
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 268 527 3.0E-07
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 250 545 3.0E-07
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 327 543 3.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 250 545 3.0E-07
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 314 512 3.0E-07
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 268 542 4.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 278 512 4.0E-07
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 268 527 7.0E-07
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 275 546 9.0E-07
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 275 554 1.0E-06
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 314 512 1.0E-06
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 275 571 1.0E-06
sp|Q6JEL3|KLH10_RAT Kelch-like protein 10 OS=Rattus norvegicus GN=Klhl10 PE=1 SV=1 278 545 1.0E-06
sp|Q9D5V2|KLH10_MOUSE Kelch-like protein 10 OS=Mus musculus GN=Klhl10 PE=1 SV=1 278 545 1.0E-06
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 250 545 2.0E-06
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 303 573 2.0E-06
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 303 573 2.0E-06
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 306 557 2.0E-06
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 231 518 2.0E-06
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 313 543 2.0E-06
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 275 554 2.0E-06
sp|Q6JEL2|KLH10_HUMAN Kelch-like protein 10 OS=Homo sapiens GN=KLHL10 PE=1 SV=1 278 545 2.0E-06
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 231 467 3.0E-06
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 314 520 3.0E-06
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 275 554 3.0E-06
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 275 571 3.0E-06
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 275 571 3.0E-06
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 275 546 4.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 253 386 5.0E-06
sp|Q04652|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4 311 554 5.0E-06
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 314 512 5.0E-06
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 262 566 6.0E-06
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 275 554 9.0E-06
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 307 512 9.0E-06
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=1 SV=1 307 512 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7882
MSPDSAAPADKPSPAMAKAVARSDDKPQPLPRSHTPGHLAGGSPADGRRKTTDLALRRRPQPPSIASAAPKSPPS
SSRVDDGESDDDDGDDDDNDNDNDDEDDDDEDDDDEDDEDEDERQNHKGKQPQRQPQKKSRKHLQRQSQKQAQKQ
AQSRQPPAKATSRSKSLAPAPTPAPIPTPAPAPASAPAPAPVPAPAPASTPAPVPAPASRQTTTATTTRVSRPPR
GPHVPFPPLQDPKDAPDVKPAPASAMYWSKAFTSGSPHHNLRAHTATPVGSNIIVFGGWDSRACFNNVYVLDGDA
FYWSVPHIVGEMPPPLRAMTCTAVGKKLVLFGGGDGPAYYNAVYVLDTLNFRWTRPRILGDDAPCARRAHSACFY
RNGIYVFGGGDGDKALNDIWRLDVADVSKMTWRLISGHDDSEADDAPRPKARGYHTGNMSGSKLIIYGGSDGTEC
FDDVWIYDVERRIWKAVDIPVSFRRLSHTATLVGSYLFVLGGHDGEEYRNDLLLLNLVTMTWDKREAYGKAPSAR
GYHTTVLHDSRLLMIGGFDGTVVYGDVTILELARHAYYPQISQFTIDQQSVCIYILALQK
Coding >Ophio5|7882
ATGTCGCCGGACTCGGCCGCGCCGGCCGACAAGCCGTCACCGGCCATGGCTAAGGCGGTGGCGCGGTCCGACGAC
AAGCCGCAGCCGTTGCCGCGAAGCCATACGCCAGGCCATCTGGCCGGCGGCAGCCCGGCCGACGGTCGTCGAAAG
ACAACAGACCTTGCCCTTCGCCGCCGTCCACAGCCGCCTTCTATCGCCTCCGCTGCCCCGAAGTCACCGCCCAGC
TCGAGCAGAGTCGACGATGGCGAGAGCGACGATGACGATGGTGACGACGATGACAATGACAATGACAATGACGAT
GAAGACGATGACGATGAAGACGATGACGATGAAGACGACGAGGATGAAGACGAGCGCCAAAATCACAAGGGGAAG
CAGCCTCAGAGGCAGCCCCAGAAGAAGTCCCGGAAACATCTCCAGAGGCAGTCCCAGAAGCAGGCCCAAAAGCAG
GCCCAGTCGCGGCAGCCTCCCGCAAAGGCCACCAGCCGCAGCAAGTCGTTGGCCCCAGCTCCGACTCCCGCTCCG
ATCCCGACCCCAGCTCCGGCTCCGGCTTCAGCTCCAGCTCCAGCTCCGGTCCCGGCGCCAGCTCCGGCCTCGACT
CCGGCTCCGGTTCCAGCTCCGGCTTCGCGACAGACGACGACAGCCACAACCACACGCGTCAGCCGTCCGCCGCGC
GGGCCGCACGTTCCCTTTCCTCCGCTCCAAGACCCCAAGGATGCGCCCGACGTGAAGCCGGCGCCGGCATCGGCC
ATGTACTGGTCCAAAGCCTTCACCAGCGGCTCACCACACCACAACCTACGAGCGCACACGGCGACGCCCGTTGGC
TCCAACATCATCGTCTTCGGAGGATGGGACTCGCGAGCATGCTTCAACAACGTCTACGTCCTTGACGGCGACGCC
TTTTACTGGTCCGTGCCGCACATCGTCGGCGAGATGCCACCGCCGCTACGGGCCATGACATGCACAGCCGTCGGC
AAGAAGCTCGTTCTCTTCGGCGGCGGCGACGGGCCGGCCTATTACAACGCCGTCTACGTCCTCGACACGCTCAAC
TTTCGCTGGACGAGGCCGCGCATCCTCGGTGACGATGCGCCGTGCGCGCGCCGTGCTCACTCGGCTTGCTTCTAC
CGCAATGGCATATACGTGTTTGGCGGAGGCGACGGCGACAAGGCTCTCAACGACATTTGGCGCCTCGACGTCGCT
GACGTCTCCAAGATGACCTGGAGGCTGATATCGGGCCACGACGACAGCGAGGCAGACGACGCTCCCCGACCAAAG
GCCCGCGGCTATCACACCGGCAACATGAGCGGCAGCAAGCTCATCATCTACGGCGGCTCCGACGGCACCGAATGC
TTCGACGACGTCTGGATCTACGATGTCGAAAGGCGCATCTGGAAGGCCGTCGACATTCCCGTCTCCTTTCGCCGC
CTGTCGCACACTGCAACCCTGGTCGGCTCCTATCTCTTCGTCCTAGGCGGCCACGACGGCGAAGAGTACCGCAAC
GACTTGCTACTGCTCAACCTCGTCACCATGACCTGGGATAAGCGCGAAGCCTACGGCAAGGCCCCTTCCGCCCGT
GGCTATCACACCACCGTACTGCACGACAGCAGGCTGCTGATGATCGGCGGCTTTGACGGCACCGTCGTCTACGGA
GACGTCACAATTCTCGAGCTGGCAAGGCACGCCTACTATCCGCAGATCAGCCAGTTTACCATTGACCAACAGTCT
GTCTGTATATACATACTCGCTCTTCAAAAG
Transcript >Ophio5|7882
ATGTCGCCGGACTCGGCCGCGCCGGCCGACAAGCCGTCACCGGCCATGGCTAAGGCGGTGGCGCGGTCCGACGAC
AAGCCGCAGCCGTTGCCGCGAAGCCATACGCCAGGCCATCTGGCCGGCGGCAGCCCGGCCGACGGTCGTCGAAAG
ACAACAGACCTTGCCCTTCGCCGCCGTCCACAGCCGCCTTCTATCGCCTCCGCTGCCCCGAAGTCACCGCCCAGC
TCGAGCAGAGTCGACGATGGCGAGAGCGACGATGACGATGGTGACGACGATGACAATGACAATGACAATGACGAT
GAAGACGATGACGATGAAGACGATGACGATGAAGACGACGAGGATGAAGACGAGCGCCAAAATCACAAGGGGAAG
CAGCCTCAGAGGCAGCCCCAGAAGAAGTCCCGGAAACATCTCCAGAGGCAGTCCCAGAAGCAGGCCCAAAAGCAG
GCCCAGTCGCGGCAGCCTCCCGCAAAGGCCACCAGCCGCAGCAAGTCGTTGGCCCCAGCTCCGACTCCCGCTCCG
ATCCCGACCCCAGCTCCGGCTCCGGCTTCAGCTCCAGCTCCAGCTCCGGTCCCGGCGCCAGCTCCGGCCTCGACT
CCGGCTCCGGTTCCAGCTCCGGCTTCGCGACAGACGACGACAGCCACAACCACACGCGTCAGCCGTCCGCCGCGC
GGGCCGCACGTTCCCTTTCCTCCGCTCCAAGACCCCAAGGATGCGCCCGACGTGAAGCCGGCGCCGGCATCGGCC
ATGTACTGGTCCAAAGCCTTCACCAGCGGCTCACCACACCACAACCTACGAGCGCACACGGCGACGCCCGTTGGC
TCCAACATCATCGTCTTCGGAGGATGGGACTCGCGAGCATGCTTCAACAACGTCTACGTCCTTGACGGCGACGCC
TTTTACTGGTCCGTGCCGCACATCGTCGGCGAGATGCCACCGCCGCTACGGGCCATGACATGCACAGCCGTCGGC
AAGAAGCTCGTTCTCTTCGGCGGCGGCGACGGGCCGGCCTATTACAACGCCGTCTACGTCCTCGACACGCTCAAC
TTTCGCTGGACGAGGCCGCGCATCCTCGGTGACGATGCGCCGTGCGCGCGCCGTGCTCACTCGGCTTGCTTCTAC
CGCAATGGCATATACGTGTTTGGCGGAGGCGACGGCGACAAGGCTCTCAACGACATTTGGCGCCTCGACGTCGCT
GACGTCTCCAAGATGACCTGGAGGCTGATATCGGGCCACGACGACAGCGAGGCAGACGACGCTCCCCGACCAAAG
GCCCGCGGCTATCACACCGGCAACATGAGCGGCAGCAAGCTCATCATCTACGGCGGCTCCGACGGCACCGAATGC
TTCGACGACGTCTGGATCTACGATGTCGAAAGGCGCATCTGGAAGGCCGTCGACATTCCCGTCTCCTTTCGCCGC
CTGTCGCACACTGCAACCCTGGTCGGCTCCTATCTCTTCGTCCTAGGCGGCCACGACGGCGAAGAGTACCGCAAC
GACTTGCTACTGCTCAACCTCGTCACCATGACCTGGGATAAGCGCGAAGCCTACGGCAAGGCCCCTTCCGCCCGT
GGCTATCACACCACCGTACTGCACGACAGCAGGCTGCTGATGATCGGCGGCTTTGACGGCACCGTCGTCTACGGA
GACGTCACAATTCTCGAGCTGGCAAGGCACGCCTACTATCCGCAGATCAGCCAGTTTACCATTGACCAACAGTCT
GTCTGTATATACATACTCGCTCTTCAAAAGTGA
Gene >Ophio5|7882
ATGTCGCCGGACTCGGCCGCGCCGGCCGACAAGCCGTCACCGGCCATGGCTAAGGCGGTGGCGCGGTCCGACGAC
AAGCCGCAGCCGTTGCCGCGAAGCCATACGCCAGGCCATCTGGCCGGCGGCAGCCCGGCCGACGGTCGTCGAAAG
ACAACAGACCTTGCCCTTCGCCGCCGTCCACAGCCGCCTTCTATCGCCTCCGCTGCCCCGAAGTCACCGCCCAGC
TCGAGCAGAGTCGACGATGGCGAGAGCGACGATGACGATGGTGACGACGATGACAATGACAATGACAATGACGAT
GAAGACGATGACGATGAAGACGATGACGATGAAGACGACGAGGATGAAGACGAGCGCCAAAATCACAAGGGGAAG
CAGCCTCAGAGGCAGCCCCAGAAGAAGTCCCGGAAACATCTCCAGAGGCAGTCCCAGAAGCAGGCCCAAAAGCAG
GCCCAGTCGCGGCAGCCTCCCGCAAAGGCCACCAGCCGCAGCAAGTCGTTGGCCCCAGCTCCGACTCCCGCTCCG
ATCCCGACCCCAGCTCCGGCTCCGGCTTCAGCTCCAGCTCCAGCTCCGGTCCCGGCGCCAGCTCCGGCCTCGACT
CCGGCTCCGGTTCCAGCTCCGGCTTCGCGACAGACGACGACAGCCACAACCACACGCGTCAGCCGTCCGCCGCGC
GGGCCGCACGTTCCCTTTCCTCCGCTCCAAGACCCCAAGGATGCGCCCGACGTGAAGCCGGCGCCGGCATCGGCC
ATGTACTGGTCCAAAGCCTTCACCAGCGGCTCACCACACCACAACCTACGAGCGCACACGGCGACGCCCGTTGGC
TCCAACATCATCGTCTTCGGAGGATGGGACTCGCGAGCATGCTTCAACAACGTCTACGTCCTTGACGGCGACGCC
TTTTACTGGTCCGTGCCGCACATCGTCGGCGAGATGCCACCGCCGCTACGGGCCATGACATGCACAGCCGTCGGC
AAGAAGCTCGTTCTCTTCGGCGGCGGCGACGGGCCGGCCTATTACAACGCCGTCTACGTCCTCGACACGCTCAAC
TTTCGCTGGACGAGGCCGCGCATCCTCGGTGACGATGCGCCGTGCGCGCGCCGTGCTCACTCGGCTTGCTTCTAC
CGCAATGGCATATACGTGTTTGGCGGAGGCGACGGCGACAAGGCTCTCAACGACATTTGGCGCCTCGACGTCGCT
GACGTCTCCAAGATGACCTGGAGGCTGATATCGGGCCACGACGACAGCGAGGCAGACGACGCTCCCCGACCAAAG
GCCCGCGGCTATCACACCGGCAACATGAGCGGCAGCAAGCTCATCATCTACGGCGGCTCCGACGGCACCGAATGC
TTCGACGACGTCTGGATCTACGATGTCGAAAGGCGCATCTGGAAGGCCGTCGACATTCCCGTCTCCTTTCGCCGC
CTGTCGCACACTGCAACCCTGGTCGGCTCCTATCTCTTCGTCCTAGGCGGCCACGACGGCGAAGAGTACCGCAAC
GACTTGCTACTGCTCAACCTCGTCACCATGACCTGGGATAAGCGCGAAGCCTACGGCAAGGCCCCTTCCGCCCGT
GGCTATCACACCACCGTACTGCACGACAGCAGGCTGCTGATGATCGGCGGCTTTGACGGCACCGTCGTCTACGGA
GACGTCACAATTCTCGAGCTGGCAAGGCACGCCTACTATCCGCAGATCAGCCAGTTTACCATTGACGTATGAAGA
CGCGGCTCAGAGCTTAATGGAAAGCGGAACGCGTCGGCCGAGGAAGGGGAGTTGCACCAGTAGTGAAGCAACAGT
CTGTCTGTATATACATGTAAGCTTTCTTCTTGGTCCATCGGATTTCGACATGGACTTCCATCAACCTTCCGGAAA
GGTTGGTCCCTCTTCCAGTCTAAATTTCGCTGCACAGACTCGCTCTTCAAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail