Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7881
Gene name
Locationscaffold_81:20612..21387
Strand+
Gene length (bp)775
Transcript length (bp)696
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 4.0E-05 139 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P3B2|RCF2_SCHPO Respiratory supercomplex factor 2 homolog C1565.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rcf2 PE=3 SV=1 6 222 7.0E-22
sp|P53721|RCF2_YEAST Respiratory supercomplex factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF2 PE=1 SV=1 1 184 1.0E-19

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 116 135 19
3 145 167 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7881
MKVLSKAEEDAHYSVVLKGGIVGGIAGFGLGLGGVLFASRRYPAFRGLTLPFRTFLVTSSATFCAIVNADRQSTI
FQRSQHVDSGYRDGSQRAADMIRENESKYQRFLAWGRDHRYSIVFVSWVASMGAALVMVGRAPISTPQKLVQARV
YAQALTLAVLVVSAIFEMSDAKEGSGRWETVLVVDPNDPEHKHVIEKKVHKEDYQGQDLWKDMVEAEERRLKAQE
ANSTKS
Coding >Ophio5|7881
ATGAAAGTGCTCAGCAAGGCAGAAGAGGATGCTCACTACTCTGTCGTCCTCAAGGGCGGCATCGTCGGCGGCATC
GCCGGTTTCGGCCTCGGGCTCGGTGGCGTGCTCTTCGCTTCCCGTCGTTATCCGGCCTTTCGCGGCCTGACGCTG
CCGTTTCGTACCTTTCTCGTCACCTCGAGCGCTACCTTTTGCGCCATCGTCAATGCCGATCGTCAGAGCACCATC
TTTCAGCGCTCGCAGCATGTTGATAGCGGCTATCGCGATGGCAGTCAGCGCGCTGCTGACATGATTCGCGAGAAT
GAGTCGAAATACCAGCGCTTTCTCGCTTGGGGCCGCGACCATCGCTACTCCATCGTCTTCGTTTCCTGGGTCGCT
AGCATGGGCGCCGCCTTGGTCATGGTCGGCCGCGCGCCCATCTCTACTCCCCAGAAGCTCGTCCAGGCCCGTGTC
TACGCGCAGGCTCTGACCCTTGCCGTCCTCGTCGTCTCCGCCATCTTCGAAATGTCAGACGCCAAAGAGGGCAGC
GGCCGCTGGGAGACGGTCCTCGTTGTCGACCCCAACGACCCGGAGCACAAGCATGTCATTGAAAAGAAGGTGCAC
AAGGAGGATTACCAGGGCCAGGACCTGTGGAAGGACATGGTCGAAGCCGAGGAAAGACGGCTCAAGGCCCAAGAG
GCCAACTCTACCAAGTCG
Transcript >Ophio5|7881
ATGAAAGTGCTCAGCAAGGCAGAAGAGGATGCTCACTACTCTGTCGTCCTCAAGGGCGGCATCGTCGGCGGCATC
GCCGGTTTCGGCCTCGGGCTCGGTGGCGTGCTCTTCGCTTCCCGTCGTTATCCGGCCTTTCGCGGCCTGACGCTG
CCGTTTCGTACCTTTCTCGTCACCTCGAGCGCTACCTTTTGCGCCATCGTCAATGCCGATCGTCAGAGCACCATC
TTTCAGCGCTCGCAGCATGTTGATAGCGGCTATCGCGATGGCAGTCAGCGCGCTGCTGACATGATTCGCGAGAAT
GAGTCGAAATACCAGCGCTTTCTCGCTTGGGGCCGCGACCATCGCTACTCCATCGTCTTCGTTTCCTGGGTCGCT
AGCATGGGCGCCGCCTTGGTCATGGTCGGCCGCGCGCCCATCTCTACTCCCCAGAAGCTCGTCCAGGCCCGTGTC
TACGCGCAGGCTCTGACCCTTGCCGTCCTCGTCGTCTCCGCCATCTTCGAAATGTCAGACGCCAAAGAGGGCAGC
GGCCGCTGGGAGACGGTCCTCGTTGTCGACCCCAACGACCCGGAGCACAAGCATGTCATTGAAAAGAAGGTGCAC
AAGGAGGATTACCAGGGCCAGGACCTGTGGAAGGACATGGTCGAAGCCGAGGAAAGACGGCTCAAGGCCCAAGAG
GCCAACTCTACCAAGTCGTAG
Gene >Ophio5|7881
ATGAAAGTGCTCAGCAAGGCAGAAGAGGATGCTCACTACTCTGTCGTCCTCAAGGGCGGCATCGTCGGCGGCATC
GCCGGTTTCGGCCTCGGGCTCGGTGGCGTGCTCTTCGCTTCCCGTCGTTATCCGGCCTTTCGCGGCCTGACGCTG
CCGTTTCGTACCTTTCTCGTCACCTCGAGCGCTACCTTTTGCGCCATCGTCAATGCCGATCGTCAGAGCACCATC
TTTCAGCGCTCGCAGCATGTTGATAGCGGCTATCGCGATGGCAGTCAGCGCGCTGCTGACATGATTCGCGAGAAT
GAGTCGAAATACCAGCGCTTTCTCGCTTGGGGCCGCGACCATCGCTACTCCATCGTCTTCGTTTCCTGGGTCGCT
AGCATGGGCGCCGCCTTGGTCATGGTCGGCCGCGCGCCCATCTCTACTCCCCAGAAGCTCGTCCAGGCCCGTGTC
TACGCGCAGGCTCTGACCCTTGCCGTCCTCGTCGTCTCCGCCATCTTCGAAATGTCAGACGCCAAAGAGGGCAGC
GGCCGCTGGGAGACGGTCCTCGTTGTCGACCCCAACGACCCGGAGCACAAGCATGTCATTGAAAAGAAGGTGCAC
AAGGAGGATTACCAGGGCCAGGACCTGTGGAAGGGTACGAATCTCATCAATTTTGCCCGTTTCCGGTTGACCTTT
CGTCATTGTCCTCGTTGCTAACTTGATGCCTGTCCCAGACATGGTCGAAGCCGAGGAAAGACGGCTCAAGGCCCA
AGAGGCCAACTCTACCAAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail