Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7873
Gene name
Locationscaffold_808:6036..7058
Strand-
Gene length (bp)1022
Transcript length (bp)849
Coding sequence length (bp)846
Protein length (aa) 282

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-10 3 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 59 251 3.0E-41
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 251 2.0E-37
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 7 236 5.0E-10
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 69 240 1.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 28 235 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 59 251 3.0E-41
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 251 2.0E-37
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 7 236 5.0E-10
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 69 240 1.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 28 235 3.0E-07
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 63 235 1.0E-06
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 2 245 3.0E-06
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 3 251 7.0E-06
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 69 261 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1353 0.2308 0.2984 0.2645 0.1961 0.1411 0.6308 0.4115 0.3721 0.0164

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.992461

Transmembrane Domains

Domain # Start End Length
1 4 23 19
2 75 97 22
3 112 134 22
4 171 193 22
5 197 219 22
6 232 249 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 15.60 5.31 25.90
CcL In ants, during behavior modification 278.03 135.07 420.99
CcD In ants, recently dead 252.07 130.72 373.43

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.743274 no

Orthologs

Orthofinder run ID4
Orthogroup575
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4853
Ophiocordyceps australis map64 (Brazil) OphauB2|5300
Ophiocordyceps camponoti-floridani Ophcf2|02062
Ophiocordyceps camponoti-floridani Ophcf2|07428
Ophiocordyceps camponoti-rufipedis Ophun1|1032
Ophiocordyceps kimflemingae Ophio5|7873 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5648
Ophiocordyceps subramaniannii Hirsu2|5649

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7873
MYFLAGYGALICFLLLLLLPETLPRDDDDPSHPVHDRDNHDDQPRPKNSARLASALRHVLLDPLRVLLILRFPPV
LLTVLVAAIAFGSLFIVNVAIQQTFSAPPYSFSQRTVGLLYLPTGLGYFVTSLFGGRWIDHIMARRARKARRYDE
KGRLVYLPEDRMGENMWLANVVYPLGLLLFGWTINYAVYWLVPSVGGFFFGVASMMVFATSTTMLTEFVRKRSST
GVAVNNFVRNILSCVGTIVAAPWLDAGSAASGCFAGTRVRGAAAWTSFSTGSHSPPS
Coding >Ophio5|7873
ATGTATTTCCTCGCCGGCTATGGTGCCCTGATCTGCTTCCTCTTGCTGCTGCTTCTCCCCGAGACGCTGCCGAGG
GACGACGACGATCCGTCGCACCCCGTCCATGACCGGGACAACCACGACGACCAACCTCGTCCGAAAAATTCCGCC
CGTCTCGCTTCCGCCCTCAGACACGTCCTACTCGACCCTCTCCGTGTCCTCCTCATCCTTCGATTCCCCCCCGTC
TTGCTGACCGTCCTCGTCGCCGCCATCGCTTTCGGCTCCCTCTTCATCGTCAACGTCGCCATCCAACAGACCTTC
TCCGCCCCGCCCTACTCCTTCTCCCAACGGACCGTCGGCCTCCTCTACCTGCCCACCGGCCTCGGCTACTTCGTC
ACCTCCCTGTTCGGTGGCCGCTGGATAGATCACATCATGGCCCGTCGCGCTCGTAAAGCCCGTCGCTACGATGAA
AAGGGCCGTCTCGTCTACCTCCCCGAGGACCGTATGGGAGAGAACATGTGGCTTGCCAACGTCGTCTATCCCCTC
GGCCTGCTGCTCTTTGGCTGGACCATAAACTATGCCGTCTACTGGCTCGTGCCCTCTGTCGGCGGCTTCTTCTTT
GGCGTCGCCTCCATGATGGTCTTTGCCACATCGACCACGATGCTGACCGAGTTCGTCCGCAAACGAAGCTCGACG
GGCGTCGCCGTAAACAACTTTGTCCGCAATATACTCAGCTGCGTGGGCACCATCGTCGCCGCCCCCTGGCTCGAC
GCCGGCTCGGCGGCATCTGGGTGCTTTGCAGGAACGCGCGTCCGTGGCGCCGCCGCATGGACGAGCTTCTCAACC
GGCAGCCATAGCCCCCCGTCC
Transcript >Ophio5|7873
ATGTATTTCCTCGCCGGCTATGGTGCCCTGATCTGCTTCCTCTTGCTGCTGCTTCTCCCCGAGACGCTGCCGAGG
GACGACGACGATCCGTCGCACCCCGTCCATGACCGGGACAACCACGACGACCAACCTCGTCCGAAAAATTCCGCC
CGTCTCGCTTCCGCCCTCAGACACGTCCTACTCGACCCTCTCCGTGTCCTCCTCATCCTTCGATTCCCCCCCGTC
TTGCTGACCGTCCTCGTCGCCGCCATCGCTTTCGGCTCCCTCTTCATCGTCAACGTCGCCATCCAACAGACCTTC
TCCGCCCCGCCCTACTCCTTCTCCCAACGGACCGTCGGCCTCCTCTACCTGCCCACCGGCCTCGGCTACTTCGTC
ACCTCCCTGTTCGGTGGCCGCTGGATAGATCACATCATGGCCCGTCGCGCTCGTAAAGCCCGTCGCTACGATGAA
AAGGGCCGTCTCGTCTACCTCCCCGAGGACCGTATGGGAGAGAACATGTGGCTTGCCAACGTCGTCTATCCCCTC
GGCCTGCTGCTCTTTGGCTGGACCATAAACTATGCCGTCTACTGGCTCGTGCCCTCTGTCGGCGGCTTCTTCTTT
GGCGTCGCCTCCATGATGGTCTTTGCCACATCGACCACGATGCTGACCGAGTTCGTCCGCAAACGAAGCTCGACG
GGCGTCGCCGTAAACAACTTTGTCCGCAATATACTCAGCTGCGTGGGCACCATCGTCGCCGCCCCCTGGCTCGAC
GCCGGCTCGGCGGCATCTGGGTGCTTTGCAGGAACGCGCGTCCGTGGCGCCGCCGCATGGACGAGCTTCTCAACC
GGCAGCCATAGCCCCCCGTCCTAG
Gene >Ophio5|7873
ATGTATTTCCTCGCCGGCTATGGTGCCCTGATCTGCTTCCTCTTGCTGCTGCTTCTCCCCGAGACGCTGCCGAGG
GACGACGACGATCCGTCGCACCCCGTCCATGACCGGGACAACCACGACGACCAACCTCGTCCGAAAAATTCCGCC
CGTCTCGCTTCCGCCCTCAGACACGTCCTACTCGACCCTCTCCGTGTCCTCCTCATCCTTCGATTCCCCCCCGTC
TTGCTGACCGTCCTCGTCGCCGCCATCGCTTTCGGCTCCCTCTTCATCGTCAACGTCGCCATCCAACAGACCTTC
TCCGCCCCGCCCTACTCCTTCTCCCAACGGACCGTCGGCCTCCTCTACCTGCCCACCGGCCTCGGCTACTTCGTC
ACCTCCCTGTTCGGTGGCCGCTGGATAGATCACATCATGGCCCGTCGCGCTCGTAAAGCCCGTCGCTACGATGAA
AAGGGCCGTCTCGTCTACCTCCCCGAGGACCGTATGGGAGAGAACATGTGGCTTGCCAACGTCGTCTATCCCCTC
GGCCTGCTGCTCTTTGGCTGGACCATAAACTATGCCGTCTACTGGCTCGTGCCCTCTGTCGGCGGCTTCTTCTTT
GGCGTCGCCTCCATGATGGTCTTTGTCCGTCTTCTCATCCCCCCCCCCCTTGAAGCCTCTCTCCCTCGTCACTCA
CACGGCAACAGGCCACATCGACCACGATGCTGACCGAGTTCGTCCGCAAACGAAGCTCGACGGGCGTCGCCGTAA
ACAACTTTGTCCGCAATATACTCAGCTGCGTGGGCACCATCGTCGCCGCCCCCTGGCTCGACGCCGTCGGCCCCG
GCTACGTCTTCACCGCCGTCGGCCTCTTCTGCCTCGTCGCAGGGCTCGGCGGCATCTGGGTGCTTTGCAGGAACG
CGCGTCCGTGGCGCCGCCGCATGGACGAGCTTCTCAACCGGCAGCCATAGCCGTCAGTCAGGCTTCAATTCGGTC
AATTGGGTATAGACGCGTTGACACCTGCATGCCCAGCCCCGTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail