Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7873
Gene name
Locationscaffold_808:6036..7058
Strand-
Gene length (bp)1022
Transcript length (bp)849
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-10 3 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 59 251 3.0E-41
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 251 2.0E-37
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 7 236 5.0E-10
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 69 240 1.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 28 235 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 59 251 3.0E-41
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 251 2.0E-37
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 7 236 5.0E-10
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 69 240 1.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 28 235 3.0E-07
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 63 235 1.0E-06
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 2 245 3.0E-06
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 3 251 7.0E-06
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 69 261 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 4 23 19
2 75 97 22
3 112 134 22
4 171 193 22
5 197 219 22
6 232 249 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7873
MYFLAGYGALICFLLLLLLPETLPRDDDDPSHPVHDRDNHDDQPRPKNSARLASALRHVLLDPLRVLLILRFPPV
LLTVLVAAIAFGSLFIVNVAIQQTFSAPPYSFSQRTVGLLYLPTGLGYFVTSLFGGRWIDHIMARRARKARRYDE
KGRLVYLPEDRMGENMWLANVVYPLGLLLFGWTINYAVYWLVPSVGGFFFGVASMMVFATSTTMLTEFVRKRSST
GVAVNNFVRNILSCVGTIVAAPWLDAGSAASGCFAGTRVRGAAAWTSFSTGSHSPPS
Coding >Ophio5|7873
ATGTATTTCCTCGCCGGCTATGGTGCCCTGATCTGCTTCCTCTTGCTGCTGCTTCTCCCCGAGACGCTGCCGAGG
GACGACGACGATCCGTCGCACCCCGTCCATGACCGGGACAACCACGACGACCAACCTCGTCCGAAAAATTCCGCC
CGTCTCGCTTCCGCCCTCAGACACGTCCTACTCGACCCTCTCCGTGTCCTCCTCATCCTTCGATTCCCCCCCGTC
TTGCTGACCGTCCTCGTCGCCGCCATCGCTTTCGGCTCCCTCTTCATCGTCAACGTCGCCATCCAACAGACCTTC
TCCGCCCCGCCCTACTCCTTCTCCCAACGGACCGTCGGCCTCCTCTACCTGCCCACCGGCCTCGGCTACTTCGTC
ACCTCCCTGTTCGGTGGCCGCTGGATAGATCACATCATGGCCCGTCGCGCTCGTAAAGCCCGTCGCTACGATGAA
AAGGGCCGTCTCGTCTACCTCCCCGAGGACCGTATGGGAGAGAACATGTGGCTTGCCAACGTCGTCTATCCCCTC
GGCCTGCTGCTCTTTGGCTGGACCATAAACTATGCCGTCTACTGGCTCGTGCCCTCTGTCGGCGGCTTCTTCTTT
GGCGTCGCCTCCATGATGGTCTTTGCCACATCGACCACGATGCTGACCGAGTTCGTCCGCAAACGAAGCTCGACG
GGCGTCGCCGTAAACAACTTTGTCCGCAATATACTCAGCTGCGTGGGCACCATCGTCGCCGCCCCCTGGCTCGAC
GCCGGCTCGGCGGCATCTGGGTGCTTTGCAGGAACGCGCGTCCGTGGCGCCGCCGCATGGACGAGCTTCTCAACC
GGCAGCCATAGCCCCCCGTCC
Transcript >Ophio5|7873
ATGTATTTCCTCGCCGGCTATGGTGCCCTGATCTGCTTCCTCTTGCTGCTGCTTCTCCCCGAGACGCTGCCGAGG
GACGACGACGATCCGTCGCACCCCGTCCATGACCGGGACAACCACGACGACCAACCTCGTCCGAAAAATTCCGCC
CGTCTCGCTTCCGCCCTCAGACACGTCCTACTCGACCCTCTCCGTGTCCTCCTCATCCTTCGATTCCCCCCCGTC
TTGCTGACCGTCCTCGTCGCCGCCATCGCTTTCGGCTCCCTCTTCATCGTCAACGTCGCCATCCAACAGACCTTC
TCCGCCCCGCCCTACTCCTTCTCCCAACGGACCGTCGGCCTCCTCTACCTGCCCACCGGCCTCGGCTACTTCGTC
ACCTCCCTGTTCGGTGGCCGCTGGATAGATCACATCATGGCCCGTCGCGCTCGTAAAGCCCGTCGCTACGATGAA
AAGGGCCGTCTCGTCTACCTCCCCGAGGACCGTATGGGAGAGAACATGTGGCTTGCCAACGTCGTCTATCCCCTC
GGCCTGCTGCTCTTTGGCTGGACCATAAACTATGCCGTCTACTGGCTCGTGCCCTCTGTCGGCGGCTTCTTCTTT
GGCGTCGCCTCCATGATGGTCTTTGCCACATCGACCACGATGCTGACCGAGTTCGTCCGCAAACGAAGCTCGACG
GGCGTCGCCGTAAACAACTTTGTCCGCAATATACTCAGCTGCGTGGGCACCATCGTCGCCGCCCCCTGGCTCGAC
GCCGGCTCGGCGGCATCTGGGTGCTTTGCAGGAACGCGCGTCCGTGGCGCCGCCGCATGGACGAGCTTCTCAACC
GGCAGCCATAGCCCCCCGTCCTAG
Gene >Ophio5|7873
ATGTATTTCCTCGCCGGCTATGGTGCCCTGATCTGCTTCCTCTTGCTGCTGCTTCTCCCCGAGACGCTGCCGAGG
GACGACGACGATCCGTCGCACCCCGTCCATGACCGGGACAACCACGACGACCAACCTCGTCCGAAAAATTCCGCC
CGTCTCGCTTCCGCCCTCAGACACGTCCTACTCGACCCTCTCCGTGTCCTCCTCATCCTTCGATTCCCCCCCGTC
TTGCTGACCGTCCTCGTCGCCGCCATCGCTTTCGGCTCCCTCTTCATCGTCAACGTCGCCATCCAACAGACCTTC
TCCGCCCCGCCCTACTCCTTCTCCCAACGGACCGTCGGCCTCCTCTACCTGCCCACCGGCCTCGGCTACTTCGTC
ACCTCCCTGTTCGGTGGCCGCTGGATAGATCACATCATGGCCCGTCGCGCTCGTAAAGCCCGTCGCTACGATGAA
AAGGGCCGTCTCGTCTACCTCCCCGAGGACCGTATGGGAGAGAACATGTGGCTTGCCAACGTCGTCTATCCCCTC
GGCCTGCTGCTCTTTGGCTGGACCATAAACTATGCCGTCTACTGGCTCGTGCCCTCTGTCGGCGGCTTCTTCTTT
GGCGTCGCCTCCATGATGGTCTTTGTCCGTCTTCTCATCCCCCCCCCCCTTGAAGCCTCTCTCCCTCGTCACTCA
CACGGCAACAGGCCACATCGACCACGATGCTGACCGAGTTCGTCCGCAAACGAAGCTCGACGGGCGTCGCCGTAA
ACAACTTTGTCCGCAATATACTCAGCTGCGTGGGCACCATCGTCGCCGCCCCCTGGCTCGACGCCGTCGGCCCCG
GCTACGTCTTCACCGCCGTCGGCCTCTTCTGCCTCGTCGCAGGGCTCGGCGGCATCTGGGTGCTTTGCAGGAACG
CGCGTCCGTGGCGCCGCCGCATGGACGAGCTTCTCAACCGGCAGCCATAGCCGTCAGTCAGGCTTCAATTCGGTC
AATTGGGTATAGACGCGTTGACACCTGCATGCCCAGCCCCGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail