Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7870
Gene name
Locationscaffold_808:1167..2511
Strand+
Gene length (bp)1344
Transcript length (bp)1344
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03781 FGE-sulfatase Sulfatase-modifying factor enzyme 1 8.9E-46 171 445

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0P5L5|SUMF1_BOVIN Sulfatase-modifying factor 1 OS=Bos taurus GN=SUMF1 PE=2 SV=1 158 386 2.0E-16
sp|Q8NBK3|SUMF1_HUMAN Sulfatase-modifying factor 1 OS=Homo sapiens GN=SUMF1 PE=1 SV=3 173 386 5.0E-16
sp|Q8R0F3|SUMF1_MOUSE Sulfatase-modifying factor 1 OS=Mus musculus GN=Sumf1 PE=1 SV=2 173 386 5.0E-15
sp|Q8BPG6|SUMF2_MOUSE Sulfatase-modifying factor 2 OS=Mus musculus GN=Sumf2 PE=1 SV=2 171 382 8.0E-14
sp|Q58CP2|SUMF2_BOVIN Sulfatase-modifying factor 2 OS=Bos taurus GN=SUMF2 PE=2 SV=1 173 382 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0P5L5|SUMF1_BOVIN Sulfatase-modifying factor 1 OS=Bos taurus GN=SUMF1 PE=2 SV=1 158 386 2.0E-16
sp|Q8NBK3|SUMF1_HUMAN Sulfatase-modifying factor 1 OS=Homo sapiens GN=SUMF1 PE=1 SV=3 173 386 5.0E-16
sp|Q8R0F3|SUMF1_MOUSE Sulfatase-modifying factor 1 OS=Mus musculus GN=Sumf1 PE=1 SV=2 173 386 5.0E-15
sp|Q8BPG6|SUMF2_MOUSE Sulfatase-modifying factor 2 OS=Mus musculus GN=Sumf2 PE=1 SV=2 171 382 8.0E-14
sp|Q58CP2|SUMF2_BOVIN Sulfatase-modifying factor 2 OS=Bos taurus GN=SUMF2 PE=2 SV=1 173 382 5.0E-12
sp|Q8NBJ7|SUMF2_HUMAN Sulfatase-modifying factor 2 OS=Homo sapiens GN=SUMF2 PE=1 SV=2 172 382 3.0E-09
sp|Q822R1|PKN1_CHLCV Serine/threonine-protein kinase pkn1 OS=Chlamydophila caviae (strain GPIC) GN=pkn1 PE=3 SV=1 262 445 4.0E-09
sp|Q5RCR5|SUMF2_PONAB Sulfatase-modifying factor 2 OS=Pongo abelii GN=SUMF2 PE=2 SV=1 172 382 1.0E-08
sp|Q7AJA5|PKN1_CHLPN Serine/threonine-protein kinase pkn1 OS=Chlamydia pneumoniae GN=pkn1 PE=3 SV=1 173 447 2.0E-08
sp|Q9PKP3|PKN1_CHLMU Serine/threonine-protein kinase pkn1 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pkn1 PE=3 SV=1 168 447 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7870
MSSPLSIILALLTTVGAIISDAEVVSTSLAERKLKDLSESLRWGGTTLATYAPVVPAAREAYSTLKALKANNNSA
VPRADSYIETLGRLVVESGYILEESRNRSFQAALYDTAALLTASVNEWHYTIDVIIANLTQPETYRAPQPGSFSN
GDDTTIIDKPGTVFRDWPDGPAMVVIPTGTYTAGATDAELEEFDVPVEKQGEEKPQRKVHISKPLAFSQTEVQVW
EFAAFVRESHYKPRGGARWWDPADPAAQVFNPELNYLNPGFPQTKNSPVVAITRQDAFVYCNWLSVGTGHTYRLP
TEDEWEWAARGGTNTTFFWGHDFDLVYLYANAYDQTSKAVNMFPWEAANDTDGYAYTAPVASFRPNGYDLYDMTA
NAREFVADDWVEFLGPSAANDGSIHQGPAPFPVLRGGAWNYEPRNLRISYRDGYFSSEVSSNMFGLRLVREL
Coding >Ophio5|7870
ATGTCATCTCCTCTCTCGATTATTCTGGCTCTGCTGACGACAGTCGGAGCCATCATTTCGGATGCAGAGGTGGTG
AGCACGAGTCTCGCGGAGAGAAAACTGAAGGATCTCTCAGAATCGTTACGATGGGGCGGCACGACACTCGCTACC
TACGCCCCCGTCGTCCCGGCAGCGCGAGAGGCCTATTCAACGCTCAAAGCACTAAAGGCGAACAACAACTCGGCC
GTGCCTCGAGCCGACTCGTATATCGAAACCCTGGGCCGACTCGTCGTCGAAAGCGGCTATATCCTCGAGGAGTCT
CGCAACAGGAGCTTTCAAGCTGCCTTGTACGACACGGCTGCGCTTCTGACGGCCAGCGTTAACGAATGGCATTAT
ACTATCGATGTCATCATTGCCAACCTGACGCAGCCGGAGACGTATCGTGCGCCTCAACCGGGTAGTTTTTCCAAC
GGCGACGACACTACCATCATCGATAAGCCCGGGACCGTCTTCCGTGATTGGCCCGATGGTCCGGCCATGGTGGTG
ATTCCGACCGGAACTTATACGGCCGGAGCGACGGATGCTGAGCTGGAAGAGTTTGACGTGCCGGTGGAAAAGCAG
GGTGAGGAGAAGCCACAGCGAAAGGTTCACATCTCCAAACCGCTGGCCTTTAGTCAAACCGAGGTTCAGGTGTGG
GAATTCGCTGCCTTTGTTCGTGAGAGCCACTATAAGCCTCGTGGAGGTGCACGATGGTGGGATCCGGCCGATCCG
GCGGCTCAAGTCTTTAATCCGGAACTCAACTATCTTAACCCGGGATTTCCGCAGACGAAAAACTCACCCGTCGTG
GCAATCACCCGTCAGGATGCTTTCGTCTACTGTAACTGGCTCTCTGTCGGTACCGGTCATACGTATCGTCTCCCG
ACAGAGGATGAATGGGAGTGGGCGGCTCGAGGCGGAACCAACACGACGTTTTTTTGGGGTCATGATTTCGACCTC
GTCTATCTATACGCAAATGCCTACGATCAGACGTCGAAAGCGGTCAACATGTTTCCATGGGAAGCGGCCAATGAT
ACTGACGGCTATGCCTATACCGCTCCCGTCGCCTCCTTTCGTCCCAACGGTTACGACCTCTACGACATGACGGCC
AACGCACGCGAATTCGTAGCCGATGACTGGGTCGAGTTTCTAGGTCCTTCAGCCGCTAACGATGGATCGATTCAT
CAAGGACCGGCGCCCTTTCCCGTCCTTCGCGGCGGTGCGTGGAACTACGAACCGCGAAACCTGCGAATTAGTTAT
CGTGATGGTTACTTTTCAAGCGAGGTTTCGTCTAACATGTTTGGCTTGCGTTTGGTGCGTGAGTTG
Transcript >Ophio5|7870
ATGTCATCTCCTCTCTCGATTATTCTGGCTCTGCTGACGACAGTCGGAGCCATCATTTCGGATGCAGAGGTGGTG
AGCACGAGTCTCGCGGAGAGAAAACTGAAGGATCTCTCAGAATCGTTACGATGGGGCGGCACGACACTCGCTACC
TACGCCCCCGTCGTCCCGGCAGCGCGAGAGGCCTATTCAACGCTCAAAGCACTAAAGGCGAACAACAACTCGGCC
GTGCCTCGAGCCGACTCGTATATCGAAACCCTGGGCCGACTCGTCGTCGAAAGCGGCTATATCCTCGAGGAGTCT
CGCAACAGGAGCTTTCAAGCTGCCTTGTACGACACGGCTGCGCTTCTGACGGCCAGCGTTAACGAATGGCATTAT
ACTATCGATGTCATCATTGCCAACCTGACGCAGCCGGAGACGTATCGTGCGCCTCAACCGGGTAGTTTTTCCAAC
GGCGACGACACTACCATCATCGATAAGCCCGGGACCGTCTTCCGTGATTGGCCCGATGGTCCGGCCATGGTGGTG
ATTCCGACCGGAACTTATACGGCCGGAGCGACGGATGCTGAGCTGGAAGAGTTTGACGTGCCGGTGGAAAAGCAG
GGTGAGGAGAAGCCACAGCGAAAGGTTCACATCTCCAAACCGCTGGCCTTTAGTCAAACCGAGGTTCAGGTGTGG
GAATTCGCTGCCTTTGTTCGTGAGAGCCACTATAAGCCTCGTGGAGGTGCACGATGGTGGGATCCGGCCGATCCG
GCGGCTCAAGTCTTTAATCCGGAACTCAACTATCTTAACCCGGGATTTCCGCAGACGAAAAACTCACCCGTCGTG
GCAATCACCCGTCAGGATGCTTTCGTCTACTGTAACTGGCTCTCTGTCGGTACCGGTCATACGTATCGTCTCCCG
ACAGAGGATGAATGGGAGTGGGCGGCTCGAGGCGGAACCAACACGACGTTTTTTTGGGGTCATGATTTCGACCTC
GTCTATCTATACGCAAATGCCTACGATCAGACGTCGAAAGCGGTCAACATGTTTCCATGGGAAGCGGCCAATGAT
ACTGACGGCTATGCCTATACCGCTCCCGTCGCCTCCTTTCGTCCCAACGGTTACGACCTCTACGACATGACGGCC
AACGCACGCGAATTCGTAGCCGATGACTGGGTCGAGTTTCTAGGTCCTTCAGCCGCTAACGATGGATCGATTCAT
CAAGGACCGGCGCCCTTTCCCGTCCTTCGCGGCGGTGCGTGGAACTACGAACCGCGAAACCTGCGAATTAGTTAT
CGTGATGGTTACTTTTCAAGCGAGGTTTCGTCTAACATGTTTGGCTTGCGTTTGGTGCGTGAGTTGTGA
Gene >Ophio5|7870
ATGTCATCTCCTCTCTCGATTATTCTGGCTCTGCTGACGACAGTCGGAGCCATCATTTCGGATGCAGAGGTGGTG
AGCACGAGTCTCGCGGAGAGAAAACTGAAGGATCTCTCAGAATCGTTACGATGGGGCGGCACGACACTCGCTACC
TACGCCCCCGTCGTCCCGGCAGCGCGAGAGGCCTATTCAACGCTCAAAGCACTAAAGGCGAACAACAACTCGGCC
GTGCCTCGAGCCGACTCGTATATCGAAACCCTGGGCCGACTCGTCGTCGAAAGCGGCTATATCCTCGAGGAGTCT
CGCAACAGGAGCTTTCAAGCTGCCTTGTACGACACGGCTGCGCTTCTGACGGCCAGCGTTAACGAATGGCATTAT
ACTATCGATGTCATCATTGCCAACCTGACGCAGCCGGAGACGTATCGTGCGCCTCAACCGGGTAGTTTTTCCAAC
GGCGACGACACTACCATCATCGATAAGCCCGGGACCGTCTTCCGTGATTGGCCCGATGGTCCGGCCATGGTGGTG
ATTCCGACCGGAACTTATACGGCCGGAGCGACGGATGCTGAGCTGGAAGAGTTTGACGTGCCGGTGGAAAAGCAG
GGTGAGGAGAAGCCACAGCGAAAGGTTCACATCTCCAAACCGCTGGCCTTTAGTCAAACCGAGGTTCAGGTGTGG
GAATTCGCTGCCTTTGTTCGTGAGAGCCACTATAAGCCTCGTGGAGGTGCACGATGGTGGGATCCGGCCGATCCG
GCGGCTCAAGTCTTTAATCCGGAACTCAACTATCTTAACCCGGGATTTCCGCAGACGAAAAACTCACCCGTCGTG
GCAATCACCCGTCAGGATGCTTTCGTCTACTGTAACTGGCTCTCTGTCGGTACCGGTCATACGTATCGTCTCCCG
ACAGAGGATGAATGGGAGTGGGCGGCTCGAGGCGGAACCAACACGACGTTTTTTTGGGGTCATGATTTCGACCTC
GTCTATCTATACGCAAATGCCTACGATCAGACGTCGAAAGCGGTCAACATGTTTCCATGGGAAGCGGCCAATGAT
ACTGACGGCTATGCCTATACCGCTCCCGTCGCCTCCTTTCGTCCCAACGGTTACGACCTCTACGACATGACGGCC
AACGCACGCGAATTCGTAGCCGATGACTGGGTCGAGTTTCTAGGTCCTTCAGCCGCTAACGATGGATCGATTCAT
CAAGGACCGGCGCCCTTTCCCGTCCTTCGCGGCGGTGCGTGGAACTACGAACCGCGAAACCTGCGAATTAGTTAT
CGTGATGGTTACTTTTCAAGCGAGGTTTCGTCTAACATGTTTGGCTTGCGTTTGGTGCGTGAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail