Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7868
Gene name
Locationscaffold_806:2162..3602
Strand+
Gene length (bp)1440
Transcript length (bp)1440
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08772 NOB1_Zn_bind Nin one binding (NOB1) Zn-ribbon like 4.0E-32 330 401
PF17146 PIN_6 PIN domain of ribonuclease 1.0E-29 27 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 21 479 4.0E-92
sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 24 477 7.0E-54
sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 23 404 2.0E-38
sp|Q8BW10|NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus GN=Nob1 PE=1 SV=1 23 404 4.0E-38
sp|Q6VEU1|NOB1_RAT RNA-binding protein NOB1 OS=Rattus norvegicus GN=Nob1 PE=2 SV=1 23 404 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 21 479 4.0E-92
sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 24 477 7.0E-54
sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 23 404 2.0E-38
sp|Q8BW10|NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus GN=Nob1 PE=1 SV=1 23 404 4.0E-38
sp|Q6VEU1|NOB1_RAT RNA-binding protein NOB1 OS=Rattus norvegicus GN=Nob1 PE=2 SV=1 23 404 1.0E-36
sp|Q9ULX3|NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens GN=NOB1 PE=1 SV=1 23 404 2.0E-35
sp|Q4R537|NOB1_MACFA RNA-binding protein NOB1 OS=Macaca fascicularis GN=NOB1 PE=2 SV=1 23 401 5.0E-35
sp|Q5RBB3|NOB1_PONAB RNA-binding protein NOB1 OS=Pongo abelii GN=NOB1 PE=2 SV=1 23 404 5.0E-34
sp|Q9UZ20|NOB1_PYRAB Endoribonuclease Nob1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nob1 PE=3 SV=1 52 144 3.0E-07
sp|O58440|NOB1_PYRHO Endoribonuclease Nob1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=nob1 PE=1 SV=1 52 144 6.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5621 0.7453 0.0244 0.042 0.1704 0.0056 0.061 0.0068 0.027 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1005
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3860
Ophiocordyceps australis map64 (Brazil) OphauB2|3217
Ophiocordyceps camponoti-floridani Ophcf2|01600
Ophiocordyceps camponoti-floridani Ophcf2|01601
Ophiocordyceps camponoti-rufipedis Ophun1|773
Ophiocordyceps kimflemingae Ophio5|7868 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8667

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7868
MAAPPPELGTDPSSPRPPTTSKPIHSLVLDTGPLIRNDPPVSVLMAKAEALFTIPSVLAEIRDQATRSRVETTLR
PLLTLRTPKPESLRFIQGFAKKTGDLAVLSRPDLEVLALTYELECERNGGDWRLRSTPGQKGMNGRPEKSVDEPS
SSGLEDSTGHDQHGQNALQAIGCDAAHDANAPEGQDDSNAQRLLETAVQHLTLDADEDVPTEAKAAALSQDSNPD
AQRDVLEPLPSEGRTVDETSDTTGKDVQEEEEEDGRRADESDSEGGEWITPTNVKKHQALDVTSATPSRAPEKTL
QAAVLTSDYAMQNVALRMNLNLVTPSLARITRLKNWVLRCHGCFAITKEMEKQFCPSCGQPTLLRASCSTDEHGI
FRIHLKSNFQWNKRGNVYSVPKPVHGSASGRRGKNGWGHGLMLAGDQKEYVRAVDEQRRERKKDVDLMDEDRLPA
LLSRERAGGGGGRIRVGAGRNVNAKRRHR
Coding >Ophio5|7868
ATGGCGGCGCCTCCACCGGAGCTCGGGACCGATCCAAGCTCTCCCCGCCCACCTACCACCTCCAAGCCCATCCAC
AGCCTCGTTCTCGACACAGGCCCCTTGATACGAAATGACCCGCCCGTCAGCGTTCTGATGGCAAAGGCCGAAGCT
CTCTTCACCATTCCCTCTGTCCTCGCCGAGATCCGCGACCAGGCGACTCGCTCCCGCGTCGAGACGACGCTTCGG
CCCCTGCTCACCCTGCGCACGCCTAAGCCCGAGAGCTTGCGGTTCATACAGGGCTTTGCGAAGAAGACGGGCGAC
TTGGCTGTGCTGAGTCGGCCGGACTTGGAGGTTCTGGCTCTTACCTACGAGCTCGAATGTGAACGGAATGGCGGC
GATTGGAGGTTGAGGAGCACACCTGGCCAAAAGGGCATGAACGGCCGTCCCGAGAAGTCGGTGGACGAGCCTTCC
TCGTCGGGTCTTGAAGATTCTACCGGCCATGATCAGCATGGTCAGAATGCTTTGCAGGCCATCGGCTGCGACGCG
GCGCATGATGCCAATGCCCCCGAGGGCCAGGACGACTCCAACGCACAACGGCTGCTAGAAACTGCCGTGCAGCAT
CTGACCTTGGACGCCGACGAGGACGTACCTACCGAGGCCAAAGCGGCTGCTCTGTCCCAGGACAGCAACCCTGAT
GCGCAACGCGACGTCCTAGAACCGCTCCCCAGCGAGGGCAGGACAGTCGACGAAACTTCCGACACGACCGGCAAA
GACGTGCAAGAGGAGGAAGAAGAGGATGGGCGGCGGGCAGACGAGTCCGACTCCGAAGGCGGCGAATGGATCACA
CCCACCAACGTCAAGAAGCATCAGGCCCTAGACGTCACCAGCGCCACACCCTCCCGAGCTCCCGAAAAGACACTC
CAGGCCGCAGTTCTGACGTCGGACTACGCGATGCAAAACGTAGCCTTACGAATGAACCTCAATCTCGTCACCCCC
TCCCTCGCCCGAATCACCCGGTTGAAGAACTGGGTCCTTCGCTGCCACGGCTGCTTCGCCATCACCAAAGAAATG
GAAAAGCAATTTTGCCCCTCTTGCGGCCAACCGACTCTGCTGCGCGCCAGCTGCTCGACCGACGAGCACGGCATC
TTTAGGATCCATCTCAAGAGCAACTTCCAATGGAACAAGCGCGGAAATGTCTATAGCGTGCCTAAGCCCGTCCAC
GGCAGCGCCAGTGGTCGGCGTGGGAAGAATGGGTGGGGTCATGGGTTGATGCTCGCCGGGGATCAGAAGGAGTAC
GTTCGGGCTGTGGATGAGCAGCGGCGCGAGAGGAAGAAGGATGTTGATCTCATGGATGAGGATCGTTTGCCGGCT
TTGTTGAGCAGGGAGCGTGCCGGCGGAGGGGGTGGTAGGATTCGTGTTGGTGCTGGTCGTAATGTGAACGCGAAA
CGAAGGCATAGG
Transcript >Ophio5|7868
ATGGCGGCGCCTCCACCGGAGCTCGGGACCGATCCAAGCTCTCCCCGCCCACCTACCACCTCCAAGCCCATCCAC
AGCCTCGTTCTCGACACAGGCCCCTTGATACGAAATGACCCGCCCGTCAGCGTTCTGATGGCAAAGGCCGAAGCT
CTCTTCACCATTCCCTCTGTCCTCGCCGAGATCCGCGACCAGGCGACTCGCTCCCGCGTCGAGACGACGCTTCGG
CCCCTGCTCACCCTGCGCACGCCTAAGCCCGAGAGCTTGCGGTTCATACAGGGCTTTGCGAAGAAGACGGGCGAC
TTGGCTGTGCTGAGTCGGCCGGACTTGGAGGTTCTGGCTCTTACCTACGAGCTCGAATGTGAACGGAATGGCGGC
GATTGGAGGTTGAGGAGCACACCTGGCCAAAAGGGCATGAACGGCCGTCCCGAGAAGTCGGTGGACGAGCCTTCC
TCGTCGGGTCTTGAAGATTCTACCGGCCATGATCAGCATGGTCAGAATGCTTTGCAGGCCATCGGCTGCGACGCG
GCGCATGATGCCAATGCCCCCGAGGGCCAGGACGACTCCAACGCACAACGGCTGCTAGAAACTGCCGTGCAGCAT
CTGACCTTGGACGCCGACGAGGACGTACCTACCGAGGCCAAAGCGGCTGCTCTGTCCCAGGACAGCAACCCTGAT
GCGCAACGCGACGTCCTAGAACCGCTCCCCAGCGAGGGCAGGACAGTCGACGAAACTTCCGACACGACCGGCAAA
GACGTGCAAGAGGAGGAAGAAGAGGATGGGCGGCGGGCAGACGAGTCCGACTCCGAAGGCGGCGAATGGATCACA
CCCACCAACGTCAAGAAGCATCAGGCCCTAGACGTCACCAGCGCCACACCCTCCCGAGCTCCCGAAAAGACACTC
CAGGCCGCAGTTCTGACGTCGGACTACGCGATGCAAAACGTAGCCTTACGAATGAACCTCAATCTCGTCACCCCC
TCCCTCGCCCGAATCACCCGGTTGAAGAACTGGGTCCTTCGCTGCCACGGCTGCTTCGCCATCACCAAAGAAATG
GAAAAGCAATTTTGCCCCTCTTGCGGCCAACCGACTCTGCTGCGCGCCAGCTGCTCGACCGACGAGCACGGCATC
TTTAGGATCCATCTCAAGAGCAACTTCCAATGGAACAAGCGCGGAAATGTCTATAGCGTGCCTAAGCCCGTCCAC
GGCAGCGCCAGTGGTCGGCGTGGGAAGAATGGGTGGGGTCATGGGTTGATGCTCGCCGGGGATCAGAAGGAGTAC
GTTCGGGCTGTGGATGAGCAGCGGCGCGAGAGGAAGAAGGATGTTGATCTCATGGATGAGGATCGTTTGCCGGCT
TTGTTGAGCAGGGAGCGTGCCGGCGGAGGGGGTGGTAGGATTCGTGTTGGTGCTGGTCGTAATGTGAACGCGAAA
CGAAGGCATAGGTAG
Gene >Ophio5|7868
ATGGCGGCGCCTCCACCGGAGCTCGGGACCGATCCAAGCTCTCCCCGCCCACCTACCACCTCCAAGCCCATCCAC
AGCCTCGTTCTCGACACAGGCCCCTTGATACGAAATGACCCGCCCGTCAGCGTTCTGATGGCAAAGGCCGAAGCT
CTCTTCACCATTCCCTCTGTCCTCGCCGAGATCCGCGACCAGGCGACTCGCTCCCGCGTCGAGACGACGCTTCGG
CCCCTGCTCACCCTGCGCACGCCTAAGCCCGAGAGCTTGCGGTTCATACAGGGCTTTGCGAAGAAGACGGGCGAC
TTGGCTGTGCTGAGTCGGCCGGACTTGGAGGTTCTGGCTCTTACCTACGAGCTCGAATGTGAACGGAATGGCGGC
GATTGGAGGTTGAGGAGCACACCTGGCCAAAAGGGCATGAACGGCCGTCCCGAGAAGTCGGTGGACGAGCCTTCC
TCGTCGGGTCTTGAAGATTCTACCGGCCATGATCAGCATGGTCAGAATGCTTTGCAGGCCATCGGCTGCGACGCG
GCGCATGATGCCAATGCCCCCGAGGGCCAGGACGACTCCAACGCACAACGGCTGCTAGAAACTGCCGTGCAGCAT
CTGACCTTGGACGCCGACGAGGACGTACCTACCGAGGCCAAAGCGGCTGCTCTGTCCCAGGACAGCAACCCTGAT
GCGCAACGCGACGTCCTAGAACCGCTCCCCAGCGAGGGCAGGACAGTCGACGAAACTTCCGACACGACCGGCAAA
GACGTGCAAGAGGAGGAAGAAGAGGATGGGCGGCGGGCAGACGAGTCCGACTCCGAAGGCGGCGAATGGATCACA
CCCACCAACGTCAAGAAGCATCAGGCCCTAGACGTCACCAGCGCCACACCCTCCCGAGCTCCCGAAAAGACACTC
CAGGCCGCAGTTCTGACGTCGGACTACGCGATGCAAAACGTAGCCTTACGAATGAACCTCAATCTCGTCACCCCC
TCCCTCGCCCGAATCACCCGGTTGAAGAACTGGGTCCTTCGCTGCCACGGCTGCTTCGCCATCACCAAAGAAATG
GAAAAGCAATTTTGCCCCTCTTGCGGCCAACCGACTCTGCTGCGCGCCAGCTGCTCGACCGACGAGCACGGCATC
TTTAGGATCCATCTCAAGAGCAACTTCCAATGGAACAAGCGCGGAAATGTCTATAGCGTGCCTAAGCCCGTCCAC
GGCAGCGCCAGTGGTCGGCGTGGGAAGAATGGGTGGGGTCATGGGTTGATGCTCGCCGGGGATCAGAAGGAGTAC
GTTCGGGCTGTGGATGAGCAGCGGCGCGAGAGGAAGAAGGATGTTGATCTCATGGATGAGGATCGTTTGCCGGCT
TTGTTGAGCAGGGAGCGTGCCGGCGGAGGGGGTGGTAGGATTCGTGTTGGTGCTGGTCGTAATGTGAACGCGAAA
CGAAGGCATAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail