Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7860
Gene name
Locationscaffold_803:266..1387
Strand+
Gene length (bp)1121
Transcript length (bp)903
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02077 SURF4 SURF4 family 7.4E-98 37 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74559|SURF4_SCHPO Surfeit locus protein 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.06 PE=3 SV=1 45 300 2.0E-88
sp|P53337|ERV29_YEAST ER-derived vesicles protein ERV29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV29 PE=1 SV=1 1 300 5.0E-73
sp|O18405|SURF4_DROME Surfeit locus protein 4 homolog OS=Drosophila melanogaster GN=Surf4 PE=2 SV=1 35 300 2.0E-62
sp|Q800K9|SURF4_CHICK Surfeit locus protein 4 OS=Gallus gallus GN=SURF4 PE=2 SV=1 38 300 2.0E-54
sp|A7YY49|SURF4_BOVIN Surfeit locus protein 4 OS=Bos taurus GN=SURF4 PE=2 SV=1 41 300 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74559|SURF4_SCHPO Surfeit locus protein 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.06 PE=3 SV=1 45 300 2.0E-88
sp|P53337|ERV29_YEAST ER-derived vesicles protein ERV29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV29 PE=1 SV=1 1 300 5.0E-73
sp|O18405|SURF4_DROME Surfeit locus protein 4 homolog OS=Drosophila melanogaster GN=Surf4 PE=2 SV=1 35 300 2.0E-62
sp|Q800K9|SURF4_CHICK Surfeit locus protein 4 OS=Gallus gallus GN=SURF4 PE=2 SV=1 38 300 2.0E-54
sp|A7YY49|SURF4_BOVIN Surfeit locus protein 4 OS=Bos taurus GN=SURF4 PE=2 SV=1 41 300 2.0E-54
sp|O57590|SURF4_TAKRU Surfeit locus protein 4 OS=Takifugu rubripes GN=surf4 PE=3 SV=1 38 300 3.0E-54
sp|Q7SZQ7|SURF4_DANRE Surfeit locus protein 4 OS=Danio rerio GN=surf4 PE=2 SV=1 38 300 4.0E-54
sp|Q64310|SURF4_MOUSE Surfeit locus protein 4 OS=Mus musculus GN=Surf4 PE=1 SV=1 41 300 4.0E-54
sp|Q5R705|SURF4_PONAB Surfeit locus protein 4 OS=Pongo abelii GN=SURF4 PE=2 SV=1 41 300 5.0E-54
sp|O15260|SURF4_HUMAN Surfeit locus protein 4 OS=Homo sapiens GN=SURF4 PE=1 SV=3 41 300 5.0E-54
sp|Q18864|SURF4_CAEEL Surfeit locus protein 4 homolog OS=Caenorhabditis elegans GN=sft-4 PE=2 SV=1 38 300 7.0E-50
sp|O45731|YFC7_CAEEL Uncharacterized protein T02E1.7 OS=Caenorhabditis elegans GN=T02E1.7 PE=3 SV=1 38 298 1.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22
2 123 142 19
3 146 165 19
4 185 204 19
5 208 230 22
6 237 256 19
7 271 293 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 458.07 222.44 693.71
CcL In ants, during behavior modification 173.72 67.65 279.79
CcD In ants, recently dead 180.77 98.28 263.26

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.901941 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7860
MSHRGPSGYGVGGPGPYGASPSDESNGNILDQIRPYTSKVEDIMDNFSEPIKPYLPAIGRFLIVVTFLEDALRIV
TQWSDQLIYLRDYRHIPGGITHLFLIINVLAMIACSGLVIIRKYSDYAVAGLMGVVVTQALGYGLIFDLNFFLRN
LSVMGGLLMVLSDSWVRKSKAFAGLPQMDEKDRKMYFQLAGRVLLIFLFIGFVFSGQWSIWRVLVCFMGAGACIM
VVVGFKAKFSAILLVVILSIFNLLVNNFWTLHEHHPHKDFAKYDFFQILSIVGGLLLLVNSGPGQFSIDEKKKVY
Coding >Ophio5|7860
ATGTCCCACCGCGGTCCCTCGGGCTACGGCGTCGGCGGCCCTGGGCCGTACGGCGCCTCCCCGTCGGACGAGAGC
AACGGCAATATCCTCGACCAGATTCGTCCCTATACCAGCAAGGTCGAGGATATCATGGACAACTTCAGCGAGCCC
ATCAAGCCCTATCTGCCAGCTATCGGTCGGTTTCTCATCGTCGTCACCTTTCTCGAAGACGCGCTGCGCATCGTG
ACGCAATGGAGCGATCAGCTCATCTACCTGCGCGACTACAGACACATTCCCGGCGGCATCACGCATCTGTTTCTC
ATCATCAACGTTCTCGCCATGATCGCCTGCTCGGGCCTCGTCATCATCCGCAAGTACTCGGATTACGCCGTCGCC
GGTCTCATGGGCGTCGTTGTCACTCAGGCCCTCGGTTACGGCCTCATCTTCGACCTCAATTTCTTCCTGCGAAAC
CTGTCCGTCATGGGCGGTCTGCTCATGGTCCTGTCCGACTCGTGGGTCCGCAAGTCCAAGGCCTTTGCCGGGCTC
CCGCAAATGGACGAAAAAGATCGCAAGATGTACTTTCAGCTCGCCGGCCGCGTCCTGCTCATCTTTTTGTTCATC
GGCTTCGTCTTCAGCGGCCAGTGGTCCATCTGGCGGGTCCTCGTCTGCTTCATGGGCGCCGGCGCCTGCATCATG
GTCGTCGTCGGCTTCAAGGCCAAGTTTAGCGCCATCCTGCTCGTCGTCATCCTGAGCATCTTTAACCTGCTCGTC
AACAACTTCTGGACGCTGCACGAGCACCACCCGCACAAGGACTTTGCCAAGTACGACTTCTTCCAGATTCTGTCC
ATCGTTGGCGGTCTCCTGCTCCTTGTCAACAGCGGGCCCGGACAATTCAGCATCGACGAGAAGAAGAAGGTGTAC
Transcript >Ophio5|7860
ATGTCCCACCGCGGTCCCTCGGGCTACGGCGTCGGCGGCCCTGGGCCGTACGGCGCCTCCCCGTCGGACGAGAGC
AACGGCAATATCCTCGACCAGATTCGTCCCTATACCAGCAAGGTCGAGGATATCATGGACAACTTCAGCGAGCCC
ATCAAGCCCTATCTGCCAGCTATCGGTCGGTTTCTCATCGTCGTCACCTTTCTCGAAGACGCGCTGCGCATCGTG
ACGCAATGGAGCGATCAGCTCATCTACCTGCGCGACTACAGACACATTCCCGGCGGCATCACGCATCTGTTTCTC
ATCATCAACGTTCTCGCCATGATCGCCTGCTCGGGCCTCGTCATCATCCGCAAGTACTCGGATTACGCCGTCGCC
GGTCTCATGGGCGTCGTTGTCACTCAGGCCCTCGGTTACGGCCTCATCTTCGACCTCAATTTCTTCCTGCGAAAC
CTGTCCGTCATGGGCGGTCTGCTCATGGTCCTGTCCGACTCGTGGGTCCGCAAGTCCAAGGCCTTTGCCGGGCTC
CCGCAAATGGACGAAAAAGATCGCAAGATGTACTTTCAGCTCGCCGGCCGCGTCCTGCTCATCTTTTTGTTCATC
GGCTTCGTCTTCAGCGGCCAGTGGTCCATCTGGCGGGTCCTCGTCTGCTTCATGGGCGCCGGCGCCTGCATCATG
GTCGTCGTCGGCTTCAAGGCCAAGTTTAGCGCCATCCTGCTCGTCGTCATCCTGAGCATCTTTAACCTGCTCGTC
AACAACTTCTGGACGCTGCACGAGCACCACCCGCACAAGGACTTTGCCAAGTACGACTTCTTCCAGATTCTGTCC
ATCGTTGGCGGTCTCCTGCTCCTTGTCAACAGCGGGCCCGGACAATTCAGCATCGACGAGAAGAAGAAGGTGTAC
TAG
Gene >Ophio5|7860
ATGTCCCACCGCGGTCCCTCGGGCTACGGCGTCGGCGGCCCTGGGCCGTACGGCGCCTCCCCGTCGGACGAGAGC
AACGGCAATATCCTCGACCAGATTCGTCCCTATACCAGCAAGGTCGAGGATATCATGGACAACTTCAGCGAGCCC
ATCAAGCCGTTAGTTTTTTTTTATTTTTATTTTTTTTTTCCTCGGCTCCTTCCTCTCTTACTTCGATGATACGTT
TCAGGCTGACGGAAATAAACTCTGTTCAGCTATCTGCCAGCTATCGGTCGGTTTCTCATCGTCGTCACCTTTCTC
GAAGACGCGCTGCGCATCGTGACGCAATGGAGCGATCAGCTCATCTACCTGCGCGACTACAGACACAGTACGAGT
CTAGGCCCGAGTCCCACTGCCTTGGCTGCTTTGGCTGACACAATATGGCAGTTCCCGGCGGCATCACGCATCTGT
TTCTCATCATCAACGTTCTCGCCATGATCGCCTGCTCGGGCCTCGTCATCATCCGCAAGTACTCGGATTACGCCG
TCGCCGGTCTCATGGGCGTCGTTGTCACTCAGGCCCTCGGTTACGGCCTCATCTTCGACCTCAATTTCTTCCTGC
GAAACCTGTCCGTCATGGGCGGTCTGCTCATGGTCCTGTCCGACTCGTGGGTCCGCAAGTCCAAGGCCTTTGCCG
GGCTCCCGCAAATGGACGAAAAAGATCGCAAGATGTACTTTCAGCTCGCCGGCCGCGTCCTGCTCATCTTTTTGT
TCATCGGCTTCGTCTTCAGCGGCCAGTGGTCCATCTGGCGGGTCCTCGTCTGCTTCATGGGCGCCGGCGCCTGCA
TCATGGTCGTCGTCGGCTTCAAGGCCAAGTTTAGCGCCATCCTGCTCGTCGTCATCCTGAGCATCTTTAACCTGC
TCGTCAACAACTTCTGGACGGTGAGTTGTTTCGAGAAGGGCCCGAGCGCGTCCCGCGACAGTGACTGACTCGGCT
TCATGCAGCTGCACGAGCACCACCCGCACAAGGACTTTGCCAAGTACGACTTCTTCCAGATTCTGTCCATCGTTG
GCGGTCTCCTGCTCCTTGTCAACAGCGGGCCCGGACAATTCAGCATCGACGAGAAGAAGAAGGTGTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail