Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7860
Gene name
Locationscaffold_803:266..1387
Strand+
Gene length (bp)1121
Transcript length (bp)903
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02077 SURF4 SURF4 family 7.4E-98 37 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74559|SURF4_SCHPO Surfeit locus protein 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.06 PE=3 SV=1 45 300 2.0E-88
sp|P53337|ERV29_YEAST ER-derived vesicles protein ERV29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV29 PE=1 SV=1 1 300 5.0E-73
sp|O18405|SURF4_DROME Surfeit locus protein 4 homolog OS=Drosophila melanogaster GN=Surf4 PE=2 SV=1 35 300 2.0E-62
sp|Q800K9|SURF4_CHICK Surfeit locus protein 4 OS=Gallus gallus GN=SURF4 PE=2 SV=1 38 300 2.0E-54
sp|A7YY49|SURF4_BOVIN Surfeit locus protein 4 OS=Bos taurus GN=SURF4 PE=2 SV=1 41 300 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74559|SURF4_SCHPO Surfeit locus protein 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.06 PE=3 SV=1 45 300 2.0E-88
sp|P53337|ERV29_YEAST ER-derived vesicles protein ERV29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV29 PE=1 SV=1 1 300 5.0E-73
sp|O18405|SURF4_DROME Surfeit locus protein 4 homolog OS=Drosophila melanogaster GN=Surf4 PE=2 SV=1 35 300 2.0E-62
sp|Q800K9|SURF4_CHICK Surfeit locus protein 4 OS=Gallus gallus GN=SURF4 PE=2 SV=1 38 300 2.0E-54
sp|A7YY49|SURF4_BOVIN Surfeit locus protein 4 OS=Bos taurus GN=SURF4 PE=2 SV=1 41 300 2.0E-54
sp|O57590|SURF4_TAKRU Surfeit locus protein 4 OS=Takifugu rubripes GN=surf4 PE=3 SV=1 38 300 3.0E-54
sp|Q7SZQ7|SURF4_DANRE Surfeit locus protein 4 OS=Danio rerio GN=surf4 PE=2 SV=1 38 300 4.0E-54
sp|Q64310|SURF4_MOUSE Surfeit locus protein 4 OS=Mus musculus GN=Surf4 PE=1 SV=1 41 300 4.0E-54
sp|Q5R705|SURF4_PONAB Surfeit locus protein 4 OS=Pongo abelii GN=SURF4 PE=2 SV=1 41 300 5.0E-54
sp|O15260|SURF4_HUMAN Surfeit locus protein 4 OS=Homo sapiens GN=SURF4 PE=1 SV=3 41 300 5.0E-54
sp|Q18864|SURF4_CAEEL Surfeit locus protein 4 homolog OS=Caenorhabditis elegans GN=sft-4 PE=2 SV=1 38 300 7.0E-50
sp|O45731|YFC7_CAEEL Uncharacterized protein T02E1.7 OS=Caenorhabditis elegans GN=T02E1.7 PE=3 SV=1 38 298 1.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22
2 123 142 19
3 146 165 19
4 185 204 19
5 208 230 22
6 237 256 19
7 271 293 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7860
MSHRGPSGYGVGGPGPYGASPSDESNGNILDQIRPYTSKVEDIMDNFSEPIKPYLPAIGRFLIVVTFLEDALRIV
TQWSDQLIYLRDYRHIPGGITHLFLIINVLAMIACSGLVIIRKYSDYAVAGLMGVVVTQALGYGLIFDLNFFLRN
LSVMGGLLMVLSDSWVRKSKAFAGLPQMDEKDRKMYFQLAGRVLLIFLFIGFVFSGQWSIWRVLVCFMGAGACIM
VVVGFKAKFSAILLVVILSIFNLLVNNFWTLHEHHPHKDFAKYDFFQILSIVGGLLLLVNSGPGQFSIDEKKKVY
Coding >Ophio5|7860
ATGTCCCACCGCGGTCCCTCGGGCTACGGCGTCGGCGGCCCTGGGCCGTACGGCGCCTCCCCGTCGGACGAGAGC
AACGGCAATATCCTCGACCAGATTCGTCCCTATACCAGCAAGGTCGAGGATATCATGGACAACTTCAGCGAGCCC
ATCAAGCCCTATCTGCCAGCTATCGGTCGGTTTCTCATCGTCGTCACCTTTCTCGAAGACGCGCTGCGCATCGTG
ACGCAATGGAGCGATCAGCTCATCTACCTGCGCGACTACAGACACATTCCCGGCGGCATCACGCATCTGTTTCTC
ATCATCAACGTTCTCGCCATGATCGCCTGCTCGGGCCTCGTCATCATCCGCAAGTACTCGGATTACGCCGTCGCC
GGTCTCATGGGCGTCGTTGTCACTCAGGCCCTCGGTTACGGCCTCATCTTCGACCTCAATTTCTTCCTGCGAAAC
CTGTCCGTCATGGGCGGTCTGCTCATGGTCCTGTCCGACTCGTGGGTCCGCAAGTCCAAGGCCTTTGCCGGGCTC
CCGCAAATGGACGAAAAAGATCGCAAGATGTACTTTCAGCTCGCCGGCCGCGTCCTGCTCATCTTTTTGTTCATC
GGCTTCGTCTTCAGCGGCCAGTGGTCCATCTGGCGGGTCCTCGTCTGCTTCATGGGCGCCGGCGCCTGCATCATG
GTCGTCGTCGGCTTCAAGGCCAAGTTTAGCGCCATCCTGCTCGTCGTCATCCTGAGCATCTTTAACCTGCTCGTC
AACAACTTCTGGACGCTGCACGAGCACCACCCGCACAAGGACTTTGCCAAGTACGACTTCTTCCAGATTCTGTCC
ATCGTTGGCGGTCTCCTGCTCCTTGTCAACAGCGGGCCCGGACAATTCAGCATCGACGAGAAGAAGAAGGTGTAC
Transcript >Ophio5|7860
ATGTCCCACCGCGGTCCCTCGGGCTACGGCGTCGGCGGCCCTGGGCCGTACGGCGCCTCCCCGTCGGACGAGAGC
AACGGCAATATCCTCGACCAGATTCGTCCCTATACCAGCAAGGTCGAGGATATCATGGACAACTTCAGCGAGCCC
ATCAAGCCCTATCTGCCAGCTATCGGTCGGTTTCTCATCGTCGTCACCTTTCTCGAAGACGCGCTGCGCATCGTG
ACGCAATGGAGCGATCAGCTCATCTACCTGCGCGACTACAGACACATTCCCGGCGGCATCACGCATCTGTTTCTC
ATCATCAACGTTCTCGCCATGATCGCCTGCTCGGGCCTCGTCATCATCCGCAAGTACTCGGATTACGCCGTCGCC
GGTCTCATGGGCGTCGTTGTCACTCAGGCCCTCGGTTACGGCCTCATCTTCGACCTCAATTTCTTCCTGCGAAAC
CTGTCCGTCATGGGCGGTCTGCTCATGGTCCTGTCCGACTCGTGGGTCCGCAAGTCCAAGGCCTTTGCCGGGCTC
CCGCAAATGGACGAAAAAGATCGCAAGATGTACTTTCAGCTCGCCGGCCGCGTCCTGCTCATCTTTTTGTTCATC
GGCTTCGTCTTCAGCGGCCAGTGGTCCATCTGGCGGGTCCTCGTCTGCTTCATGGGCGCCGGCGCCTGCATCATG
GTCGTCGTCGGCTTCAAGGCCAAGTTTAGCGCCATCCTGCTCGTCGTCATCCTGAGCATCTTTAACCTGCTCGTC
AACAACTTCTGGACGCTGCACGAGCACCACCCGCACAAGGACTTTGCCAAGTACGACTTCTTCCAGATTCTGTCC
ATCGTTGGCGGTCTCCTGCTCCTTGTCAACAGCGGGCCCGGACAATTCAGCATCGACGAGAAGAAGAAGGTGTAC
TAG
Gene >Ophio5|7860
ATGTCCCACCGCGGTCCCTCGGGCTACGGCGTCGGCGGCCCTGGGCCGTACGGCGCCTCCCCGTCGGACGAGAGC
AACGGCAATATCCTCGACCAGATTCGTCCCTATACCAGCAAGGTCGAGGATATCATGGACAACTTCAGCGAGCCC
ATCAAGCCGTTAGTTTTTTTTTATTTTTATTTTTTTTTTCCTCGGCTCCTTCCTCTCTTACTTCGATGATACGTT
TCAGGCTGACGGAAATAAACTCTGTTCAGCTATCTGCCAGCTATCGGTCGGTTTCTCATCGTCGTCACCTTTCTC
GAAGACGCGCTGCGCATCGTGACGCAATGGAGCGATCAGCTCATCTACCTGCGCGACTACAGACACAGTACGAGT
CTAGGCCCGAGTCCCACTGCCTTGGCTGCTTTGGCTGACACAATATGGCAGTTCCCGGCGGCATCACGCATCTGT
TTCTCATCATCAACGTTCTCGCCATGATCGCCTGCTCGGGCCTCGTCATCATCCGCAAGTACTCGGATTACGCCG
TCGCCGGTCTCATGGGCGTCGTTGTCACTCAGGCCCTCGGTTACGGCCTCATCTTCGACCTCAATTTCTTCCTGC
GAAACCTGTCCGTCATGGGCGGTCTGCTCATGGTCCTGTCCGACTCGTGGGTCCGCAAGTCCAAGGCCTTTGCCG
GGCTCCCGCAAATGGACGAAAAAGATCGCAAGATGTACTTTCAGCTCGCCGGCCGCGTCCTGCTCATCTTTTTGT
TCATCGGCTTCGTCTTCAGCGGCCAGTGGTCCATCTGGCGGGTCCTCGTCTGCTTCATGGGCGCCGGCGCCTGCA
TCATGGTCGTCGTCGGCTTCAAGGCCAAGTTTAGCGCCATCCTGCTCGTCGTCATCCTGAGCATCTTTAACCTGC
TCGTCAACAACTTCTGGACGGTGAGTTGTTTCGAGAAGGGCCCGAGCGCGTCCCGCGACAGTGACTGACTCGGCT
TCATGCAGCTGCACGAGCACCACCCGCACAAGGACTTTGCCAAGTACGACTTCTTCCAGATTCTGTCCATCGTTG
GCGGTCTCCTGCTCCTTGTCAACAGCGGGCCCGGACAATTCAGCATCGACGAGAAGAAGAAGGTGTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail