Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7857
Gene name
Locationscaffold_802:319..1995
Strand-
Gene length (bp)1676
Transcript length (bp)1578
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01485 IBR IBR domain, a half RING-finger domain 2.8E-14 272 365
PF01485 IBR IBR domain, a half RING-finger domain 7.3E-06 388 422
PF05773 RWD RWD domain 2.3E-11 11 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 14 450 6.0E-50
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 169 458 5.0E-28
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 169 450 7.0E-28
sp|Q04638|ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITT1 PE=1 SV=1 14 451 5.0E-17
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 135 421 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 14 450 6.0E-50
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 169 458 5.0E-28
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 169 450 7.0E-28
sp|Q04638|ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITT1 PE=1 SV=1 14 451 5.0E-17
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 135 421 7.0E-14
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 204 421 1.0E-13
sp|Q6ZPS6|AKIB1_MOUSE Ankyrin repeat and IBR domain-containing protein 1 OS=Mus musculus GN=Ankib1 PE=1 SV=2 204 421 3.0E-13
sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 99 421 4.0E-13
sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 204 431 6.0E-12
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 188 421 1.0E-11
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 188 421 2.0E-11
sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=4 343 421 2.0E-11
sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 99 441 3.0E-11
sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 204 431 5.0E-11
sp|Q84RR2|ARI2_ARATH Probable E3 ubiquitin-protein ligase ARI2 OS=Arabidopsis thaliana GN=ARI2 PE=2 SV=1 99 421 6.0E-11
sp|Q54CX4|Y5521_DICDI Uncharacterized protein DDB_G0292642 OS=Dictyostelium discoideum GN=DDB_G0292642 PE=3 SV=2 184 450 1.0E-10
sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=1 SV=1 187 421 2.0E-10
sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 343 421 2.0E-10
sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 204 431 2.0E-10
sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 187 421 2.0E-10
sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 343 421 2.0E-10
sp|Q22431|ARI2_CAEEL Probable protein ariadne-2 OS=Caenorhabditis elegans GN=T12E12.1 PE=3 SV=2 204 431 5.0E-10
sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 188 426 6.0E-10
sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 187 435 1.0E-09
sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 204 431 4.0E-09
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 171 421 6.0E-09
sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=1 SV=3 204 431 7.0E-09
sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 204 431 7.0E-09
sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 204 431 7.0E-09
sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 169 421 8.0E-09
sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 187 421 2.0E-08
sp|Q1L8L6|RN19B_DANRE E3 ubiquitin-protein ligase RNF19B OS=Danio rerio GN=rnf19b PE=3 SV=2 183 421 2.0E-08
sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 204 424 1.0E-07
sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 187 421 3.0E-07
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 188 444 5.0E-07
sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 188 426 5.0E-07
sp|Q6ZMZ0|RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens GN=RNF19B PE=1 SV=2 184 421 7.0E-07
sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 188 421 1.0E-06
sp|A2A7Q9|RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus GN=Rnf19b PE=1 SV=2 188 421 1.0E-06
sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 183 436 5.0E-06
sp|P50876|R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 183 436 7.0E-06
sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 183 436 7.0E-06
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 188 463 7.0E-06
sp|Q2VJ60|RN19A_PIG E3 ubiquitin-protein ligase RNF19A OS=Sus scrofa GN=RNF19A PE=2 SV=1 187 421 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6429 0.7008 0.0354 0.0491 0.1456 0.012 0.2542 0.2 0.1068 0.0158

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2384
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4958
Ophiocordyceps australis map64 (Brazil) OphauB2|2871
Ophiocordyceps camponoti-floridani Ophcf2|04881
Ophiocordyceps camponoti-rufipedis Ophun1|7019
Ophiocordyceps kimflemingae Ophio5|7857 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3345

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7857
MDNAPDDDDPRSVELETLTAIYPEIRPVDAPPFTFELDLPVQPTGPVTVLFATSQKGPEDVADDGARPQEPVDSL
LVTHLPSLCLRLTLPDGYPDSCPPLASLSTTPKWLPLQTLTALELEGPRLWEEAGRDLVAYTYIDHVQRAAEDVF
GAVSTQGTLEVNAAHKLAVLDYDVKAKRAAFERETWECGVCLDPKRGSACHRMLECAHVFCLRCLGDFYRDAIEQ
GNLSSVRCLAPNCAKERASAASSRRKPKMLVSPGELLQMGLGEDAVKRYVALRYKTELESDKDTVYCPRRWCNGA
ARSKRHRKPEGLEFGEAAEVESDADEVTGKAKFIKPADLLCVCEDCGFAFCSRCLQTWHGEFVRCTPKRNKDDLT
EEDKASLEYMQLHTSPCPTCNAPAQKTHGCNHMICSRCETHFCYLCSSWLDPANPYKHYNQQSDGKVTSCYMRLW
ELEGGDGDDVGLGYEGGRGVELEPVPDIDGLGDDDDEEEEEEEEEEDDDDDDSDDDDDDDEPGSDDEAKRLSSSV
Coding >Ophio5|7857
ATGGACAACGCTCCCGATGACGATGATCCGCGGTCCGTGGAGCTCGAGACGCTGACGGCCATCTATCCCGAGATT
CGGCCTGTGGATGCGCCTCCCTTCACCTTTGAGCTTGATCTGCCCGTTCAGCCCACCGGGCCGGTGACGGTGCTT
TTTGCCACGTCTCAGAAGGGGCCTGAAGATGTGGCAGACGATGGTGCCCGTCCGCAAGAGCCCGTCGACTCGCTG
CTCGTCACTCATCTGCCCTCACTGTGTCTTCGCCTCACCCTCCCGGACGGTTATCCGGACTCATGCCCGCCCCTG
GCCAGCCTGTCGACGACACCCAAGTGGCTACCGTTGCAGACGCTGACGGCACTCGAGCTCGAAGGCCCCAGGCTT
TGGGAAGAGGCCGGCCGCGATCTTGTTGCCTACACATACATCGACCACGTCCAGCGAGCTGCCGAGGACGTTTTT
GGCGCCGTATCGACTCAAGGCACGCTAGAGGTGAACGCGGCGCACAAGCTTGCCGTATTGGACTACGATGTCAAG
GCCAAGCGGGCCGCCTTCGAGAGGGAAACATGGGAATGCGGCGTGTGTCTGGACCCCAAGAGAGGCTCTGCTTGC
CACAGGATGCTGGAATGCGCCCACGTCTTCTGCCTCCGGTGCCTCGGAGACTTTTACCGTGATGCCATCGAGCAG
GGAAACCTGTCGTCGGTGCGATGCCTGGCACCCAACTGCGCCAAGGAGCGGGCTTCGGCAGCCTCGAGTCGCCGA
AAGCCCAAGATGCTTGTCAGCCCCGGCGAACTGCTGCAGATGGGCTTGGGGGAGGACGCGGTGAAGCGTTACGTG
GCACTCAGGTACAAGACGGAACTCGAGTCGGACAAGGACACCGTCTACTGCCCCCGGCGGTGGTGCAACGGAGCG
GCCCGATCCAAGCGGCACAGGAAACCCGAGGGGCTGGAGTTTGGCGAGGCGGCAGAGGTCGAGTCCGATGCGGAC
GAAGTGACGGGAAAGGCCAAGTTCATCAAGCCGGCCGATCTGTTGTGCGTGTGCGAGGACTGCGGCTTTGCCTTT
TGCAGTCGATGCCTGCAGACGTGGCATGGCGAGTTCGTCCGCTGCACGCCAAAACGAAACAAAGACGACCTGACG
GAGGAGGACAAGGCATCCCTCGAATACATGCAGCTGCACACCAGCCCCTGTCCGACGTGCAACGCTCCGGCCCAG
AAGACGCACGGCTGCAACCACATGATATGCTCGCGGTGCGAGACGCATTTCTGTTACCTGTGTTCGTCGTGGCTC
GATCCTGCGAACCCGTACAAGCATTACAACCAACAGAGTGACGGCAAGGTGACGTCGTGTTACATGCGGCTCTGG
GAGCTCGAGGGGGGCGATGGCGACGACGTTGGCCTTGGTTATGAGGGCGGCAGAGGGGTCGAGCTGGAGCCTGTG
CCGGACATTGACGGACTCGGCGACGACGACGACGAAGAGGAAGAAGAAGAAGAAGAAGAAGAAGATGATGATGAT
GATGACTCGGACGACGACGACGACGACGATGAGCCCGGAAGCGACGACGAGGCGAAGCGCCTCTCGTCCTCCGTC
Transcript >Ophio5|7857
ATGGACAACGCTCCCGATGACGATGATCCGCGGTCCGTGGAGCTCGAGACGCTGACGGCCATCTATCCCGAGATT
CGGCCTGTGGATGCGCCTCCCTTCACCTTTGAGCTTGATCTGCCCGTTCAGCCCACCGGGCCGGTGACGGTGCTT
TTTGCCACGTCTCAGAAGGGGCCTGAAGATGTGGCAGACGATGGTGCCCGTCCGCAAGAGCCCGTCGACTCGCTG
CTCGTCACTCATCTGCCCTCACTGTGTCTTCGCCTCACCCTCCCGGACGGTTATCCGGACTCATGCCCGCCCCTG
GCCAGCCTGTCGACGACACCCAAGTGGCTACCGTTGCAGACGCTGACGGCACTCGAGCTCGAAGGCCCCAGGCTT
TGGGAAGAGGCCGGCCGCGATCTTGTTGCCTACACATACATCGACCACGTCCAGCGAGCTGCCGAGGACGTTTTT
GGCGCCGTATCGACTCAAGGCACGCTAGAGGTGAACGCGGCGCACAAGCTTGCCGTATTGGACTACGATGTCAAG
GCCAAGCGGGCCGCCTTCGAGAGGGAAACATGGGAATGCGGCGTGTGTCTGGACCCCAAGAGAGGCTCTGCTTGC
CACAGGATGCTGGAATGCGCCCACGTCTTCTGCCTCCGGTGCCTCGGAGACTTTTACCGTGATGCCATCGAGCAG
GGAAACCTGTCGTCGGTGCGATGCCTGGCACCCAACTGCGCCAAGGAGCGGGCTTCGGCAGCCTCGAGTCGCCGA
AAGCCCAAGATGCTTGTCAGCCCCGGCGAACTGCTGCAGATGGGCTTGGGGGAGGACGCGGTGAAGCGTTACGTG
GCACTCAGGTACAAGACGGAACTCGAGTCGGACAAGGACACCGTCTACTGCCCCCGGCGGTGGTGCAACGGAGCG
GCCCGATCCAAGCGGCACAGGAAACCCGAGGGGCTGGAGTTTGGCGAGGCGGCAGAGGTCGAGTCCGATGCGGAC
GAAGTGACGGGAAAGGCCAAGTTCATCAAGCCGGCCGATCTGTTGTGCGTGTGCGAGGACTGCGGCTTTGCCTTT
TGCAGTCGATGCCTGCAGACGTGGCATGGCGAGTTCGTCCGCTGCACGCCAAAACGAAACAAAGACGACCTGACG
GAGGAGGACAAGGCATCCCTCGAATACATGCAGCTGCACACCAGCCCCTGTCCGACGTGCAACGCTCCGGCCCAG
AAGACGCACGGCTGCAACCACATGATATGCTCGCGGTGCGAGACGCATTTCTGTTACCTGTGTTCGTCGTGGCTC
GATCCTGCGAACCCGTACAAGCATTACAACCAACAGAGTGACGGCAAGGTGACGTCGTGTTACATGCGGCTCTGG
GAGCTCGAGGGGGGCGATGGCGACGACGTTGGCCTTGGTTATGAGGGCGGCAGAGGGGTCGAGCTGGAGCCTGTG
CCGGACATTGACGGACTCGGCGACGACGACGACGAAGAGGAAGAAGAAGAAGAAGAAGAAGAAGATGATGATGAT
GATGACTCGGACGACGACGACGACGACGATGAGCCCGGAAGCGACGACGAGGCGAAGCGCCTCTCGTCCTCCGTC
TGA
Gene >Ophio5|7857
ATGGACAACGCTCCCGATGACGATGATCCGCGGTCCGTGGAGCTCGAGACGCTGACGGCCATCTATCCCGAGATT
CGGCCTGTGGATGCGCCTCCCTTCACCTTTGAGCTTGATCTGCCCGTTCAGCCCACCGGGCCGGTGACGGTGCTT
TTTGCCACGTCTCAGAAGGGGCCTGAAGATGTGGCAGACGATGGTGCCCGTCCGCAAGAGCCCGTCGACTCGCTG
CTCGTCACTCATCTGCCCTCACTGTGTCTTCGCCTCACCCTCCCGGACGGTTATCCGGACTCATGCCCGCCCCTG
GCCAGCCTGTCGACGACACCCAAGTGGCTACCGTTGCAGACGCTGACGGCACTCGAGCTCGAAGGCCCCAGGCTT
TGGGAAGAGGCCGGCCGCGATCTTGTTGCCTACACATACATCGACCACGTCCAGCGAGCTGCCGAGGACGTTTTT
GGCGCCGTATCGACTCAAGGCACGCTAGAGGTGAACGCGGCGCACAAGCTTGCCGTATTGGACTACGATGTCAAG
GCCAAGCGGGCCGCCTTCGAGAGGGAAACATGGGAATGCGGCGTGTGTCTGGGTGAGTCAACCGGTGGCACCGCG
CCCTATCCAGGGCTGACACGACCAGGCAGACCCCAAGAGAGGCTCTGCTTGCCACAGGATGCTGGAATGCGCCCA
CGTCTTCTGCCTCCGGTGCCTCGGAGACTTTTACCGTGATGCCATCGAGCAGGGAAACCTGTCGTCGGTGCGATG
CCTGGCACCCAACTGCGCCAAGGAGCGGGCTTCGGCAGCCTCGAGTCGCCGAAAGCCCAAGATGCTTGTCAGCCC
CGGCGAACTGCTGCAGATGGGCTTGGGGGAGGACGCGGTGAAGCGTTACGTGGCACTCAGGTACAAGACGGAACT
CGAGTCGGACAAGGACACCGTCTACTGCCCCCGGCGGTGGTGCAACGGAGCGGCCCGATCCAAGCGGCACAGGAA
ACCCGAGGGGCTGGAGTTTGGCGAGGCGGCAGAGGTCGAGTCCGATGCGGACGAAGTGACGGGAAAGGCCAAGTT
CATCAAGCCGGCCGATCTGTTGTGCGTGTGCGAGGACTGCGGCTTTGCCTTTTGCAGTCGATGCCTGCAGACGTG
GCATGGCGAGTTCGTCCGCTGCACGCCAAAACGAAACAAAGACGACCTGACGGAGGAGGACAAGGCATCCCTCGA
ATACATGCAGCTGCACACCAGCCCCTGTCCGACGTGCAACGCTCCGGCCCAGAAGACGCACGGCTGCAACCACAT
GATATGCTCGCGGTGCGAGACGCATTTCTGTTACCTGTGTTCGTCGTGGCTCGATCCTGCGAACCCGTACAAGCA
TTACAACCAACAGAGTGACGGCAAGGTGACGTCGTGTTACATGCGGCTCTGGGAGCTCGAGGGGGGCGATGGCGA
CGACGTTGGCCTTGGTTATGAGGGCGGCAGAGGGGTCGAGCTGGAGCCTGTGCCGGACATTGACGGACTCGGCGA
CGACGACGACGAAGAGGAAGAAGAAGAAGAAGAAGAAGAAGATGATGATGATGATGACTCGGACGACGACGACGA
CGACGATGAGCCCGGAAGCGACGACGAGGCGGTAGCAAACCAAAATGACAGAGGCCAGCCTGTTGCCGTGGCCCG
AGAAGCGCCTCTCGTCCTCCGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail