Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7850
Gene name
Locationscaffold_800:692..2524
Strand-
Gene length (bp)1832
Transcript length (bp)1698
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.3E-34 70 466

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 93 511 2.0E-48
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 92 505 3.0E-41
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 44 535 1.0E-35
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 5 523 2.0E-34
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 67 492 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 93 511 2.0E-48
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 92 505 3.0E-41
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 44 535 1.0E-35
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 5 523 2.0E-34
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 67 492 4.0E-15
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 82 492 5.0E-13
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 82 492 5.0E-13
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 118 389 3.0E-10
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 118 389 4.0E-10
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 45 375 5.0E-10
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 45 375 5.0E-10
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 77 373 2.0E-09
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 78 429 3.0E-09
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 73 371 4.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 114 424 4.0E-08
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 81 373 1.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 81 373 1.0E-07
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 77 389 1.0E-06
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 108 462 6.0E-06
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 114 390 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 96 114 18
3 121 143 22
4 153 175 22
5 182 204 22
6 214 236 22
7 257 279 22
8 289 311 22
9 332 354 22
10 364 386 22
11 393 415 22
12 419 441 22
13 454 476 22
14 496 515 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7850
MEHIHNEKLVHVRKQISHHPAQGGDPEPDLEAWSTELDVKRLGWQRPAEFASTWMEVSFVVSSIGALSMADFIVD
GFQVLLPTLIEPFNIPPGSQIWPSSVVTMIAGSFLFPLGRLTDMYGGYYIFNGGLFWFTFWTLAAGFATDFVFLV
FCRAMQGLGLAAFLPAGIALLGRFYRPGPRKNLVFALYGASCPLGLFGGMLTAGLAEQVFSQWRCFFWVGGVFTG
LCCVGTILTSPRDLPPGPGVVASNPEKHKSKVSMDWPGTLTTVPGFMLVLYAAAKGTNSDNGFAAPHVVVAFLLG
IIFLGVAVYVEAKVESPLIPVEIFRVKHMKAMLLYLVLSWGVYCIYLFYTNFYIQTVLQKSSLTTALWYAPWAAA
GLLLSTLGGIIMDRIPGSWLLVPSSVSAIMAILLFALMPAEANYWLWVFPAMIFEAVSADLLWTVSNVFLTTSLP
RHHQGLAGAIISLTLFMADALFLAVGDVVEERLSEAGADASMQYKGVFWTGVVIGLAAIFVNCFIRIPEAAAELT
SEERNDLDRASWRRDSGGSVTDSDTVVASETEGLLEEPSV
Coding >Ophio5|7850
ATGGAACACATACACAATGAAAAACTCGTCCACGTTAGAAAGCAGATATCCCATCACCCAGCTCAGGGCGGGGAC
CCTGAGCCCGACTTGGAGGCATGGTCTACCGAGTTGGACGTCAAAAGGCTTGGCTGGCAGAGACCGGCCGAGTTT
GCATCGACGTGGATGGAAGTCAGCTTCGTCGTATCGTCGATTGGAGCGCTGTCCATGGCGGACTTCATCGTCGAT
GGCTTCCAAGTCCTTCTCCCCACCCTCATCGAGCCATTCAACATCCCCCCCGGCTCACAGATCTGGCCCTCGAGC
GTCGTCACCATGATCGCCGGCTCCTTTCTCTTTCCCCTCGGACGGCTAACGGACATGTACGGCGGTTATTACATC
TTCAACGGCGGTCTGTTTTGGTTCACCTTTTGGACGTTGGCCGCTGGTTTCGCCACCGACTTTGTCTTCCTCGTC
TTCTGCCGTGCTATGCAGGGTCTCGGCCTGGCTGCTTTTCTGCCCGCCGGTATCGCGCTACTGGGACGGTTCTAT
CGACCGGGCCCTCGCAAGAATCTCGTCTTTGCCCTCTACGGAGCTTCCTGTCCGCTGGGCTTGTTCGGCGGTATG
CTGACGGCCGGTCTCGCCGAACAAGTCTTCTCCCAGTGGCGATGCTTCTTCTGGGTCGGAGGCGTCTTCACCGGT
CTTTGCTGTGTCGGCACCATCCTCACCAGCCCGCGGGACTTGCCTCCGGGTCCGGGCGTAGTGGCATCCAATCCG
GAGAAACACAAGAGCAAGGTCTCCATGGACTGGCCTGGCACGCTGACGACGGTGCCGGGCTTCATGCTCGTTCTT
TATGCCGCGGCAAAGGGCACCAACTCGGACAATGGCTTCGCCGCGCCTCACGTCGTCGTGGCCTTTTTGCTCGGC
ATCATCTTCCTCGGCGTTGCCGTCTACGTCGAAGCCAAGGTCGAGTCGCCTCTGATACCGGTTGAAATCTTCAGA
GTCAAGCATATGAAGGCCATGTTGCTCTATCTGGTCTTGTCGTGGGGCGTCTACTGCATCTACCTGTTCTACACC
AACTTCTACATTCAAACCGTGCTACAAAAGTCGTCGTTGACGACGGCGCTATGGTACGCCCCGTGGGCGGCGGCC
GGCCTTCTCCTATCGACTCTAGGCGGCATCATCATGGACAGAATCCCGGGCTCCTGGCTTCTTGTCCCCTCGAGC
GTCTCGGCCATCATGGCCATCTTACTATTCGCTCTCATGCCGGCGGAAGCCAACTATTGGCTATGGGTCTTTCCC
GCTATGATCTTCGAGGCAGTATCGGCCGATCTTCTATGGACTGTGAGCAACGTCTTCTTGACGACGAGTCTGCCG
CGGCACCACCAGGGTCTGGCGGGTGCCATCATCAGCCTGACGCTATTCATGGCCGACGCCCTATTCCTCGCCGTT
GGTGACGTGGTCGAGGAACGTCTCAGCGAAGCCGGCGCCGACGCCAGCATGCAGTACAAGGGCGTCTTCTGGACA
GGCGTCGTCATCGGCCTGGCCGCCATATTCGTCAACTGTTTCATTCGCATCCCGGAGGCCGCGGCCGAACTGACG
TCTGAGGAGAGAAACGACCTCGACCGAGCCTCGTGGAGGCGAGATTCTGGCGGCTCCGTCACCGACTCGGACACG
GTCGTTGCGTCCGAGACGGAAGGCCTTTTGGAGGAGCCATCTGTT
Transcript >Ophio5|7850
ATGGAACACATACACAATGAAAAACTCGTCCACGTTAGAAAGCAGATATCCCATCACCCAGCTCAGGGCGGGGAC
CCTGAGCCCGACTTGGAGGCATGGTCTACCGAGTTGGACGTCAAAAGGCTTGGCTGGCAGAGACCGGCCGAGTTT
GCATCGACGTGGATGGAAGTCAGCTTCGTCGTATCGTCGATTGGAGCGCTGTCCATGGCGGACTTCATCGTCGAT
GGCTTCCAAGTCCTTCTCCCCACCCTCATCGAGCCATTCAACATCCCCCCCGGCTCACAGATCTGGCCCTCGAGC
GTCGTCACCATGATCGCCGGCTCCTTTCTCTTTCCCCTCGGACGGCTAACGGACATGTACGGCGGTTATTACATC
TTCAACGGCGGTCTGTTTTGGTTCACCTTTTGGACGTTGGCCGCTGGTTTCGCCACCGACTTTGTCTTCCTCGTC
TTCTGCCGTGCTATGCAGGGTCTCGGCCTGGCTGCTTTTCTGCCCGCCGGTATCGCGCTACTGGGACGGTTCTAT
CGACCGGGCCCTCGCAAGAATCTCGTCTTTGCCCTCTACGGAGCTTCCTGTCCGCTGGGCTTGTTCGGCGGTATG
CTGACGGCCGGTCTCGCCGAACAAGTCTTCTCCCAGTGGCGATGCTTCTTCTGGGTCGGAGGCGTCTTCACCGGT
CTTTGCTGTGTCGGCACCATCCTCACCAGCCCGCGGGACTTGCCTCCGGGTCCGGGCGTAGTGGCATCCAATCCG
GAGAAACACAAGAGCAAGGTCTCCATGGACTGGCCTGGCACGCTGACGACGGTGCCGGGCTTCATGCTCGTTCTT
TATGCCGCGGCAAAGGGCACCAACTCGGACAATGGCTTCGCCGCGCCTCACGTCGTCGTGGCCTTTTTGCTCGGC
ATCATCTTCCTCGGCGTTGCCGTCTACGTCGAAGCCAAGGTCGAGTCGCCTCTGATACCGGTTGAAATCTTCAGA
GTCAAGCATATGAAGGCCATGTTGCTCTATCTGGTCTTGTCGTGGGGCGTCTACTGCATCTACCTGTTCTACACC
AACTTCTACATTCAAACCGTGCTACAAAAGTCGTCGTTGACGACGGCGCTATGGTACGCCCCGTGGGCGGCGGCC
GGCCTTCTCCTATCGACTCTAGGCGGCATCATCATGGACAGAATCCCGGGCTCCTGGCTTCTTGTCCCCTCGAGC
GTCTCGGCCATCATGGCCATCTTACTATTCGCTCTCATGCCGGCGGAAGCCAACTATTGGCTATGGGTCTTTCCC
GCTATGATCTTCGAGGCAGTATCGGCCGATCTTCTATGGACTGTGAGCAACGTCTTCTTGACGACGAGTCTGCCG
CGGCACCACCAGGGTCTGGCGGGTGCCATCATCAGCCTGACGCTATTCATGGCCGACGCCCTATTCCTCGCCGTT
GGTGACGTGGTCGAGGAACGTCTCAGCGAAGCCGGCGCCGACGCCAGCATGCAGTACAAGGGCGTCTTCTGGACA
GGCGTCGTCATCGGCCTGGCCGCCATATTCGTCAACTGTTTCATTCGCATCCCGGAGGCCGCGGCCGAACTGACG
TCTGAGGAGAGAAACGACCTCGACCGAGCCTCGTGGAGGCGAGATTCTGGCGGCTCCGTCACCGACTCGGACACG
GTCGTTGCGTCCGAGACGGAAGGCCTTTTGGAGGAGCCATCTGTTTAG
Gene >Ophio5|7850
ATGGAACACATACACAATGAAAAACTCGTCCACGTTAGAAAGCAGATATCCCATCACCCAGCTCAGGGCGGGGAC
CCTGAGCCCGACTTGGAGGCATGGTCTACCGAGTTGGACGTCAAAAGGCTTGGCTGGCAGAGACCGGCCGAGTTT
GCATCGACGTGGATGGAAGTCAGCTTCGTCGTATCGTCGATTGGAGCGCTGTCCATGGCGGTACGCTTCCCTCTT
CTCACTCCCCCCCCCCCCTCCCCTAAACCGCCCTTCTCTTACGCAAAAGTATTAGGACTTCATCGTCGATGGCTT
CCAAGTCCTTCTCCCCACCCTCATCGAGCCATTCAACATCCCCCCCGGCTCACAGATCTGGCCCTCGAGCGTCGT
CACCATGATCGCCGGCTCCTTTCTCTTTCCCCTCGGACGGCTAACGGACATGTACGGCGGTTATTACATCTTCAA
CGGCGGTCTGTTTTGGTTCACCTTTTGGACGTTGGCCGCTGGTTTCGCCACCGACTTTGTCTTCCTCGTCTTCTG
CCGTGCTATGCAGGGTCTCGGCCTGGCTGCTTTTCTGCCCGCCGGTATCGCGCTACTGGGACGGTTCTATCGACC
GGGCCCTCGCAAGAATCTCGTCTTTGCCCTCTACGGAGCTTCCTGTCCGCTGGGCTTGTTCGGCGGTATGCTGAC
GGCCGGTCTCGCCGAACAAGTCTTCTCCCAGTGGCGATGCTTCTTCTGGGTCGGAGGCGTCTTCACCGGTCTTTG
CTGTGTCGGCACCATCCTCACCAGCCCGCGGGACTTGCCTCCGGGTCCGGGCGTAGTGGCATCCAATCCGGAGAA
ACACAAGAGCAAGGTCTCCATGGACTGGCCTGGCACGCTGACGACGGTGCCGGGCTTCATGCTCGTTCTTTATGC
CGCGGCAAAGGGCACCAACTCGGACAATGGCTTCGCCGCGCCTCACGTCGTCGTGGCCTTTTTGCTCGGCATCAT
CTTCCTCGGCGTTGCCGTCTACGTCGAAGCCAAGGTCGAGTCGCCTCTGATACCGGTTGAAATCTTCAGAGTCAA
GCATATGAAGGCCATGTTGCTCTATCTGGTCTTGTCGTGGGGCGTCTACTGCATCTACCTGTTCTACACCAACTT
CTAGTAGGTGGTGGCCCTTTGATCATCGCCGCTCCATGACGACGACGACGGCTGACGTGGGATATAGCATTCAAA
CCGTGCTACAAAAGTCGTCGTTGACGACGGCGCTATGGTACGCCCCGTGGGCGGCGGCCGGCCTTCTCCTATCGA
CTCTAGGCGGCATCATCATGGACAGAATCCCGGGCTCCTGGCTTCTTGTCCCCTCGAGCGTCTCGGCCATCATGG
CCATCTTACTATTCGCTCTCATGCCGGCGGAAGCCAACTATTGGCTATGGGTCTTTCCCGCTATGATCTTCGAGG
CAGTATCGGCCGATCTTCTATGGACTGTGAGCAACGTCTTCTTGACGACGAGTCTGCCGCGGCACCACCAGGGTC
TGGCGGGTGCCATCATCAGCCTGACGCTATTCATGGCCGACGCCCTATTCCTCGCCGTTGGTGACGTGGTCGAGG
AACGTCTCAGCGAAGCCGGCGCCGACGCCAGCATGCAGTACAAGGGCGTCTTCTGGACAGGCGTCGTCATCGGCC
TGGCCGCCATATTCGTCAACTGTTTCATTCGCATCCCGGAGGCCGCGGCCGAACTGACGTCTGAGGAGAGAAACG
ACCTCGACCGAGCCTCGTGGAGGCGAGATTCTGGCGGCTCCGTCACCGACTCGGACACGGTCGTTGCGTCCGAGA
CGGAAGGCCTTTTGGAGGAGCCATCTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail