Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7849
Gene name
Locationscaffold_80:48183..49101
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03932 CutC CutC family 6.1E-14 14 113
PF03932 CutC CutC family 7.1E-12 144 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NTM9|CUTC_HUMAN Copper homeostasis protein cutC homolog OS=Homo sapiens GN=CUTC PE=1 SV=1 14 262 1.0E-20
sp|Q9D8X1|CUTC_MOUSE Copper homeostasis protein cutC homolog OS=Mus musculus GN=Cutc PE=1 SV=1 14 262 2.0E-19
sp|B2RIS4|CUTC_PORG3 Copper homeostasis protein CutC OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=cutC PE=3 SV=1 12 256 3.0E-18
sp|Q7MWB6|CUTC_PORGI Copper homeostasis protein CutC OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=cutC PE=3 SV=1 12 256 4.0E-18
sp|Q73KH5|CUTC_TREDE Copper homeostasis protein CutC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cutC PE=3 SV=1 10 235 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NTM9|CUTC_HUMAN Copper homeostasis protein cutC homolog OS=Homo sapiens GN=CUTC PE=1 SV=1 14 262 1.0E-20
sp|Q9D8X1|CUTC_MOUSE Copper homeostasis protein cutC homolog OS=Mus musculus GN=Cutc PE=1 SV=1 14 262 2.0E-19
sp|B2RIS4|CUTC_PORG3 Copper homeostasis protein CutC OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=cutC PE=3 SV=1 12 256 3.0E-18
sp|Q7MWB6|CUTC_PORGI Copper homeostasis protein CutC OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=cutC PE=3 SV=1 12 256 4.0E-18
sp|Q73KH5|CUTC_TREDE Copper homeostasis protein CutC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cutC PE=3 SV=1 10 235 1.0E-16
sp|B0URL9|CUTC_HISS2 Copper homeostasis protein CutC OS=Histophilus somni (strain 2336) GN=cutC PE=3 SV=1 12 235 2.0E-15
sp|Q9CNA6|CUTC_PASMU Copper homeostasis protein CutC OS=Pasteurella multocida (strain Pm70) GN=cutC PE=3 SV=1 12 235 2.0E-15
sp|Q87DU4|CUTC_XYLFT Copper homeostasis protein CutC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cutC PE=3 SV=1 14 236 1.0E-13
sp|Q8PI07|CUTC_XANAC Copper homeostasis protein CutC OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cutC PE=3 SV=2 12 257 1.0E-12
sp|B8F7C5|CUTC_HAEPS Copper homeostasis protein CutC OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=cutC PE=3 SV=1 12 245 2.0E-12
sp|Q6LU78|CUTC_PHOPR Copper homeostasis protein CutC OS=Photobacterium profundum GN=cutC PE=3 SV=1 12 235 4.0E-12
sp|A6L8P3|CUTC_PARD8 Copper homeostasis protein CutC OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=cutC PE=3 SV=1 14 257 7.0E-12
sp|B7MW68|CUTC_ECO81 Copper homeostasis protein CutC OS=Escherichia coli O81 (strain ED1a) GN=cutC PE=3 SV=1 14 236 1.0E-11
sp|B7MBT3|CUTC_ECO45 Copper homeostasis protein CutC OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cutC PE=3 SV=1 14 236 1.0E-11
sp|A1AC35|CUTC_ECOK1 Copper homeostasis protein CutC OS=Escherichia coli O1:K1 / APEC GN=cutC PE=3 SV=1 14 236 1.0E-11
sp|Q1RAR0|CUTC_ECOUT Copper homeostasis protein CutC OS=Escherichia coli (strain UTI89 / UPEC) GN=cutC PE=3 SV=1 14 236 1.0E-11
sp|A6TB41|CUTC_KLEP7 Copper homeostasis protein CutC OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cutC PE=3 SV=1 14 197 1.0E-11
sp|B5XPZ4|CUTC_KLEP3 Copper homeostasis protein CutC OS=Klebsiella pneumoniae (strain 342) GN=cutC PE=3 SV=1 14 197 2.0E-11
sp|P67825|CUTC_SHIFL Copper homeostasis protein CutC OS=Shigella flexneri GN=cutC PE=1 SV=1 14 236 4.0E-11
sp|A7ZN00|CUTC_ECO24 Copper homeostasis protein CutC OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|B7M2G5|CUTC_ECO8A Copper homeostasis protein CutC OS=Escherichia coli O8 (strain IAI1) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|C4ZQF8|CUTC_ECOBW Copper homeostasis protein CutC OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|B1XHE2|CUTC_ECODH Copper homeostasis protein CutC OS=Escherichia coli (strain K12 / DH10B) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|P67826|CUTC_ECOLI Copper homeostasis protein CutC OS=Escherichia coli (strain K12) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|Q0T3Q3|CUTC_SHIF8 Copper homeostasis protein CutC OS=Shigella flexneri serotype 5b (strain 8401) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|Q3Z2Q2|CUTC_SHISS Copper homeostasis protein CutC OS=Shigella sonnei (strain Ss046) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|Q9VF71|CUTC_DROME Copper homeostasis protein cutC homolog OS=Drosophila melanogaster GN=CG6136 PE=2 SV=1 12 197 4.0E-11
sp|B7L7S7|CUTC_ECO55 Copper homeostasis protein CutC OS=Escherichia coli (strain 55989 / EAEC) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|B6I1F2|CUTC_ECOSE Copper homeostasis protein CutC OS=Escherichia coli (strain SE11) GN=cutC PE=3 SV=1 14 236 4.0E-11
sp|Q9PDN8|CUTC_XYLFA Copper homeostasis protein CutC OS=Xylella fastidiosa (strain 9a5c) GN=cutC PE=3 SV=1 14 236 9.0E-11
sp|A7MT89|CUTC_VIBCB Copper homeostasis protein CutC OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cutC PE=3 SV=1 31 247 2.0E-10
sp|A9MUB2|CUTC_SALPB Copper homeostasis protein CutC OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cutC PE=3 SV=1 14 197 2.0E-10
sp|B4TYT0|CUTC_SALSV Copper homeostasis protein CutC OS=Salmonella schwarzengrund (strain CVM19633) GN=cutC PE=3 SV=1 14 197 3.0E-10
sp|B5R144|CUTC_SALEP Copper homeostasis protein CutC OS=Salmonella enteritidis PT4 (strain P125109) GN=cutC PE=3 SV=1 14 197 3.0E-10
sp|B5R8D0|CUTC_SALG2 Copper homeostasis protein CutC OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cutC PE=3 SV=1 14 197 3.0E-10
sp|Q5PMZ0|CUTC_SALPA Copper homeostasis protein CutC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cutC PE=3 SV=1 14 197 3.0E-10
sp|B5BH48|CUTC_SALPK Copper homeostasis protein CutC OS=Salmonella paratyphi A (strain AKU_12601) GN=cutC PE=3 SV=1 14 197 3.0E-10
sp|B7NBM5|CUTC_ECOLU Copper homeostasis protein CutC OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cutC PE=3 SV=1 14 197 3.0E-10
sp|Q9A5T7|CUTC_CAUCR Copper homeostasis protein CutC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cutC PE=3 SV=1 11 236 4.0E-10
sp|B8GZC1|CUTC_CAUCN Copper homeostasis protein CutC OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cutC PE=3 SV=1 11 236 4.0E-10
sp|B4T805|CUTC_SALHS Copper homeostasis protein CutC OS=Salmonella heidelberg (strain SL476) GN=cutC PE=3 SV=1 14 197 6.0E-10
sp|B5FSM4|CUTC_SALDC Copper homeostasis protein CutC OS=Salmonella dublin (strain CT_02021853) GN=cutC PE=3 SV=1 14 197 7.0E-10
sp|Q8ZNV0|CUTC_SALTY Copper homeostasis protein CutC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cutC PE=3 SV=1 14 197 7.0E-10
sp|B5F3I3|CUTC_SALA4 Copper homeostasis protein CutC OS=Salmonella agona (strain SL483) GN=cutC PE=3 SV=1 14 197 7.0E-10
sp|Q54K76|CUTC_DICDI Copper homeostasis protein cutC homolog OS=Dictyostelium discoideum GN=cutc PE=3 SV=1 12 170 1.0E-09
sp|Q7N557|CUTC_PHOLL Copper homeostasis protein CutC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cutC PE=3 SV=1 14 236 4.0E-09
sp|B4ETN7|CUTC_PROMH Copper homeostasis protein CutC OS=Proteus mirabilis (strain HI4320) GN=cutC PE=3 SV=1 14 197 5.0E-09
sp|A4WBM9|CUTC_ENT38 Copper homeostasis protein CutC OS=Enterobacter sp. (strain 638) GN=cutC PE=3 SV=1 14 197 6.0E-09
sp|C3LSY3|CUTC_VIBCM Copper homeostasis protein CutC OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cutC PE=3 SV=1 31 261 6.0E-09
sp|Q9KU00|CUTC_VIBCH Copper homeostasis protein CutC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cutC PE=3 SV=1 31 261 6.0E-09
sp|A5F8U2|CUTC_VIBC3 Copper homeostasis protein CutC OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cutC PE=3 SV=1 31 261 6.0E-09
sp|B6EK72|CUTC_ALISL Copper homeostasis protein CutC OS=Aliivibrio salmonicida (strain LFI1238) GN=cutC PE=3 SV=1 12 235 9.0E-09
sp|A8AFG8|CUTC_CITK8 Copper homeostasis protein CutC OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cutC PE=3 SV=1 14 197 9.0E-09
sp|A6UF02|CUTC_SINMW Copper homeostasis protein CutC OS=Sinorhizobium medicae (strain WSM419) GN=cutC PE=3 SV=1 11 247 1.0E-08
sp|Q7NY61|CUTC_CHRVO Copper homeostasis protein CutC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cutC PE=3 SV=1 14 257 1.0E-08
sp|A7FID5|CUTC_YERP3 Copper homeostasis protein CutC OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cutC PE=3 SV=1 14 170 3.0E-08
sp|B5F9Z0|CUTC_VIBFM Copper homeostasis protein CutC OS=Vibrio fischeri (strain MJ11) GN=cutC PE=3 SV=1 31 235 4.0E-08
sp|A1JRM5|CUTC_YERE8 Copper homeostasis protein CutC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cutC PE=3 SV=1 14 170 4.0E-08
sp|Q66AU9|CUTC_YERPS Copper homeostasis protein CutC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cutC PE=3 SV=1 14 170 5.0E-08
sp|B2K314|CUTC_YERPB Copper homeostasis protein CutC OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cutC PE=3 SV=1 14 170 5.0E-08
sp|B1JLM0|CUTC_YERPY Copper homeostasis protein CutC OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cutC PE=3 SV=1 14 170 6.0E-08
sp|Q5E3C5|CUTC_VIBF1 Copper homeostasis protein CutC OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cutC PE=3 SV=1 31 235 6.0E-08
sp|B0RQ55|CUTC_XANCB Copper homeostasis protein CutC OS=Xanthomonas campestris pv. campestris (strain B100) GN=cutC PE=3 SV=1 12 236 7.0E-08
sp|Q89ZG1|CUTC_BACTN Copper homeostasis protein CutC OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cutC PE=3 SV=1 10 257 1.0E-07
sp|A4TJL0|CUTC_YERPP Copper homeostasis protein CutC OS=Yersinia pestis (strain Pestoides F) GN=cutC PE=3 SV=1 14 170 1.0E-07
sp|Q1CJH5|CUTC_YERPN Copper homeostasis protein CutC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cutC PE=3 SV=1 14 170 1.0E-07
sp|Q8ZEV5|CUTC_YERPE Copper homeostasis protein CutC OS=Yersinia pestis GN=cutC PE=3 SV=1 14 170 1.0E-07
sp|Q1C825|CUTC_YERPA Copper homeostasis protein CutC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cutC PE=3 SV=1 14 170 1.0E-07
sp|Q8UCA5|CUTC_AGRFC Copper homeostasis protein CutC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cutC PE=3 SV=1 12 236 1.0E-07
sp|B7VJR1|CUTC_VIBTL Copper homeostasis protein CutC OS=Vibrio tasmaniensis (strain LGP32) GN=cutC PE=3 SV=1 14 235 2.0E-07
sp|A9QYY3|CUTC_YERPG Copper homeostasis protein CutC OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cutC PE=3 SV=1 14 170 2.0E-07
sp|Q8DEX2|CUTC_VIBVU Copper homeostasis protein CutC OS=Vibrio vulnificus (strain CMCP6) GN=cutC PE=3 SV=1 31 240 2.0E-07
sp|Q92SZ1|CUTC_RHIME Copper homeostasis protein CutC OS=Rhizobium meliloti (strain 1021) GN=cutC PE=3 SV=1 11 247 2.0E-07
sp|Q8P6Q4|CUTC_XANCP Copper homeostasis protein CutC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cutC PE=3 SV=1 12 236 5.0E-07
sp|Q4UXF8|CUTC_XANC8 Copper homeostasis protein CutC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cutC PE=3 SV=1 12 236 5.0E-07
sp|Q5XDL5|Y363_STRP6 CutC-like protein M6_Spy0363 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0363 PE=1 SV=1 33 235 5.0E-07
sp|Q7MNH9|CUTC_VIBVY Copper homeostasis protein CutC OS=Vibrio vulnificus (strain YJ016) GN=cutC PE=3 SV=1 31 240 9.0E-07
sp|B2VJB9|CUTC_ERWT9 Copper homeostasis protein CutC OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cutC PE=3 SV=1 14 170 2.0E-06
sp|C6DFE1|CUTC_PECCP Copper homeostasis protein CutC OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cutC PE=3 SV=1 14 197 6.0E-06
sp|Q2NTJ9|CUTC_SODGM Copper homeostasis protein CutC OS=Sodalis glossinidius (strain morsitans) GN=cutC PE=3 SV=1 12 104 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7849
MPPPNRPRYRRMPLEVAVFSPAAALQAQRLGANRIELNATGSYSVGGLTPPVSDLVQLLARRELNIPVHIMIRPR
AAPEDGSPDFMYSDEEIVQMVRSIHDFKDARVMNPLFGDRFVVGALRLSSGHSSDGSDDGSSTSPLSHVRIDQDV
CRIFVNEAKPFRCVFHRAFDAIAAASRSVDGGQLLLHLGFEGVLTAGGLYGTCCDTDNVDEVDHMCHRLAGRVNI
IVGGGLRRHNVGPAASQLAVYDDNTVWFHTSAVQVRDGVVTEDIDTDELHGLVNQLALTSPAWKDPAGHWLRVYG
PGARR
Coding >Ophio5|7849
ATGCCTCCCCCCAACCGCCCCCGATATCGCCGCATGCCTCTCGAGGTAGCCGTCTTCTCCCCCGCCGCCGCCCTC
CAGGCACAGAGGCTGGGCGCCAACCGTATCGAGCTCAACGCGACCGGCTCCTACTCCGTCGGCGGCTTAACCCCC
CCGGTATCCGACCTCGTTCAACTACTGGCAAGGCGAGAGCTCAACATCCCCGTCCACATCATGATTCGTCCTCGA
GCCGCCCCCGAAGACGGGAGCCCCGACTTCATGTATTCCGACGAGGAAATCGTCCAGATGGTGCGGTCCATCCAC
GACTTCAAAGACGCCCGCGTCATGAATCCTCTGTTCGGAGATCGTTTCGTCGTCGGAGCCCTTCGTCTCTCTTCC
GGACACAGCTCCGATGGGAGCGATGACGGCTCCTCTACCTCGCCCTTGTCCCATGTCCGTATCGACCAGGACGTC
TGTCGAATCTTTGTCAACGAGGCTAAACCTTTCCGCTGCGTCTTTCATCGCGCTTTTGACGCCATCGCCGCTGCT
AGCCGTAGTGTCGATGGCGGCCAACTGCTGCTCCATCTCGGCTTCGAAGGCGTCCTTACCGCCGGAGGCCTCTAC
GGAACTTGCTGTGACACAGACAACGTCGATGAGGTCGACCACATGTGCCATCGCCTTGCCGGCCGTGTTAACATC
ATCGTCGGTGGCGGTCTTCGTCGTCATAATGTCGGTCCTGCTGCCTCTCAGCTCGCCGTCTACGACGACAATACT
GTCTGGTTTCATACCAGCGCTGTCCAGGTTCGTGACGGCGTCGTTACCGAGGACATTGATACCGATGAGCTTCAT
GGCCTCGTCAACCAGCTGGCCTTGACTTCGCCGGCCTGGAAGGATCCGGCCGGTCACTGGCTCAGGGTCTATGGT
CCAGGTGCGCGCCGA
Transcript >Ophio5|7849
ATGCCTCCCCCCAACCGCCCCCGATATCGCCGCATGCCTCTCGAGGTAGCCGTCTTCTCCCCCGCCGCCGCCCTC
CAGGCACAGAGGCTGGGCGCCAACCGTATCGAGCTCAACGCGACCGGCTCCTACTCCGTCGGCGGCTTAACCCCC
CCGGTATCCGACCTCGTTCAACTACTGGCAAGGCGAGAGCTCAACATCCCCGTCCACATCATGATTCGTCCTCGA
GCCGCCCCCGAAGACGGGAGCCCCGACTTCATGTATTCCGACGAGGAAATCGTCCAGATGGTGCGGTCCATCCAC
GACTTCAAAGACGCCCGCGTCATGAATCCTCTGTTCGGAGATCGTTTCGTCGTCGGAGCCCTTCGTCTCTCTTCC
GGACACAGCTCCGATGGGAGCGATGACGGCTCCTCTACCTCGCCCTTGTCCCATGTCCGTATCGACCAGGACGTC
TGTCGAATCTTTGTCAACGAGGCTAAACCTTTCCGCTGCGTCTTTCATCGCGCTTTTGACGCCATCGCCGCTGCT
AGCCGTAGTGTCGATGGCGGCCAACTGCTGCTCCATCTCGGCTTCGAAGGCGTCCTTACCGCCGGAGGCCTCTAC
GGAACTTGCTGTGACACAGACAACGTCGATGAGGTCGACCACATGTGCCATCGCCTTGCCGGCCGTGTTAACATC
ATCGTCGGTGGCGGTCTTCGTCGTCATAATGTCGGTCCTGCTGCCTCTCAGCTCGCCGTCTACGACGACAATACT
GTCTGGTTTCATACCAGCGCTGTCCAGGTTCGTGACGGCGTCGTTACCGAGGACATTGATACCGATGAGCTTCAT
GGCCTCGTCAACCAGCTGGCCTTGACTTCGCCGGCCTGGAAGGATCCGGCCGGTCACTGGCTCAGGGTCTATGGT
CCAGGTGCGCGCCGATAA
Gene >Ophio5|7849
ATGCCTCCCCCCAACCGCCCCCGATATCGCCGCATGCCTCTCGAGGTAGCCGTCTTCTCCCCCGCCGCCGCCCTC
CAGGCACAGAGGCTGGGCGCCAACCGTATCGAGCTCAACGCGACCGGCTCCTACTCCGTCGGCGGCTTAACCCCC
CCGGTATCCGACCTCGTTCAACTACTGGCAAGGCGAGAGCTCAACATCCCCGTCCACATCATGATTCGTCCTCGA
GCCGCCCCCGAAGACGGGAGCCCCGACTTCATGTATTCCGACGAGGAAATCGTCCAGATGGTGCGGTCCATCCAC
GACTTCAAAGACGCCCGCGTCATGAATCCTCTGTTCGGAGATCGTTTCGTCGTCGGAGCCCTTCGTCTCTCTTCC
GGACACAGCTCCGATGGGAGCGATGACGGCTCCTCTACCTCGCCCTTGTCCCATGTCCGTATCGACCAGGACGTC
TGTCGAATCTTTGTCAACGAGGCTAAACCTTTCCGCTGCGTCTTTCATCGCGCTTTTGACGCCATCGCCGCTGCT
AGCCGTAGTGTCGATGGCGGCCAACTGCTGCTCCATCTCGGCTTCGAAGGCGTCCTTACCGCCGGAGGCCTCTAC
GGAACTTGCTGTGACACAGACAACGTCGATGAGGTCGACCACATGTGCCATCGCCTTGCCGGCCGTGTTAACATC
ATCGTCGGTGGCGGTCTTCGTCGTCATAATGTCGGTCCTGCTGCCTCTCAGCTCGCCGTCTACGACGACAATACT
GTCTGGTTTCATACCAGCGCTGTCCAGGTTCGTGACGGCGTCGTTACCGAGGACATTGATACCGATGAGCTTCAT
GGCCTCGTCAACCAGCTGGCCTTGACTTCGCCGGCCTGGAAGGATCCGGCCGGTCACTGGCTCAGGGTCTATGGT
CCAGGTGCGCGCCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail