Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7846
Gene name
Locationscaffold_80:40560..42564
Strand-
Gene length (bp)2004
Transcript length (bp)2004
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03815 LCCL LCCL domain 4.1E-20 187 291

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40514|YIG7_YEAST Uncharacterized protein YIL067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL067C PE=1 SV=1 54 657 4.0E-68

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 133 150 17
2 328 350 22
3 360 382 22
4 402 424 22
5 439 458 19
6 471 493 22
7 513 532 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7846
MASRYHDGDDYDDDDDGGGESQALMTGMDQGEADAHDGAVPPVVDHPDQPLDTSLQIQDDDRPPTPRFIQDEQAW
KRWKWVPYPVRRVAKVVARWSIGPPDPRPYRIRPVFPAIQHLPLNLVDRFLPQRLYRVWLLMVYFSIWLVAFALV
KRKGNMATEVAGWGQPQTIGCGASYWGAGNYCGLDGSQCRPFTDSGFAFRCSSSCASYMVLNPRAVGDQEIIYSP
LVIGGPSNDVRPEQATYRGDSYICAAAIHAGIISNQMGGCGVVNLVGRQQGFVSSQRNGITSTGFDSYFPLSFQF
LPGLSCSSDDSRWSLLAVSAVFTTLLSLFTASPALFFFPTFIGLFWTVGMALDPPPQPTVTALFSNVLGKFLPAM
FIAWVMYDRMGVRRTLKDLTAQVEKTILWLGACWVGAMTNHTLGFIPIQRLNSHDLNQQPGAKAALAIIVMVLTV
VAASQIWFFRKEGRLVKYLKLYAIFLAAILVALGLPGLNLRLHHYITALVLLPGTSMQMRPSLLYQGLLVGLFIN
GVARWGFDSVLQTPQSLQGDAQQDSLLPVIHPPQIHLGGEFGDTSNITFRWDPPVGSQYDGMSVLVNDVERFRTY
FGDAGEKSDFLWSRNSTLGLAEYFRFAFMTGSDSNDYTKAGTWTADGQWRDMAAGPSSVEAEAASSL
Coding >Ophio5|7846
ATGGCCAGCCGCTATCATGACGGCGACGACTACGACGACGACGACGACGGCGGCGGCGAGTCTCAGGCCCTTATG
ACAGGGATGGATCAAGGTGAAGCCGACGCCCACGACGGGGCCGTTCCTCCCGTCGTGGACCATCCGGATCAGCCC
CTCGACACGTCGCTCCAGATCCAAGACGACGACCGTCCGCCCACGCCGCGCTTCATTCAGGACGAGCAGGCTTGG
AAGCGATGGAAATGGGTTCCTTATCCCGTGCGCCGTGTCGCCAAGGTCGTGGCAAGGTGGTCAATCGGACCCCCC
GATCCCAGGCCATATCGCATCCGACCTGTCTTCCCCGCCATCCAGCATCTCCCTTTGAATCTTGTCGATCGCTTT
CTGCCCCAGCGCCTGTACCGCGTCTGGCTCCTGATGGTCTACTTTTCCATATGGCTCGTCGCCTTCGCCCTCGTC
AAGCGCAAAGGCAACATGGCTACTGAGGTGGCCGGCTGGGGACAGCCCCAGACCATCGGTTGCGGCGCTTCATAC
TGGGGCGCCGGCAACTATTGCGGCCTCGACGGCTCCCAGTGCCGACCCTTTACCGACAGCGGCTTCGCCTTCCGC
TGCTCCAGCAGCTGCGCGAGCTACATGGTCCTGAACCCGAGGGCTGTCGGCGACCAAGAGATCATCTATAGCCCG
CTCGTCATTGGCGGTCCCTCCAACGACGTGCGGCCAGAGCAGGCCACTTATCGTGGTGACTCGTACATCTGCGCC
GCCGCCATTCACGCCGGAATCATCTCCAACCAGATGGGCGGCTGCGGCGTCGTCAACCTCGTCGGCCGGCAGCAG
GGCTTCGTCAGTTCGCAGCGGAACGGCATCACCAGCACCGGCTTCGATTCCTACTTTCCCCTTTCCTTTCAGTTC
CTCCCTGGCCTCAGCTGCTCCTCGGACGACTCGCGCTGGTCCCTTCTGGCCGTGTCTGCCGTCTTCACCACGTTG
CTTTCTCTCTTCACCGCCTCCCCGGCACTCTTCTTCTTTCCCACCTTTATTGGCCTCTTTTGGACCGTCGGCATG
GCGCTGGATCCGCCGCCGCAGCCGACGGTCACTGCCCTCTTTTCCAACGTCCTCGGCAAGTTCCTCCCGGCCATG
TTCATAGCCTGGGTCATGTACGATCGGATGGGCGTCCGGCGCACGCTCAAGGACCTGACGGCGCAGGTGGAGAAG
ACGATCCTCTGGCTCGGGGCTTGCTGGGTCGGGGCCATGACCAACCACACGCTCGGCTTCATCCCGATCCAGCGG
CTCAACTCGCATGATCTCAACCAGCAGCCGGGCGCCAAGGCGGCACTGGCAATCATTGTCATGGTCCTCACCGTC
GTCGCCGCCTCGCAGATCTGGTTCTTCAGGAAAGAGGGCCGACTGGTCAAGTACCTCAAGCTCTACGCCATCTTC
TTGGCTGCCATCCTCGTCGCCCTCGGCCTTCCAGGGCTCAACCTACGTCTCCATCACTACATCACTGCTCTCGTG
CTGCTGCCGGGGACCAGCATGCAGATGAGGCCTTCTCTGCTGTATCAGGGCCTCCTCGTCGGCCTCTTCATCAAC
GGCGTCGCCCGTTGGGGGTTCGATTCCGTGCTGCAGACGCCGCAGTCGCTGCAGGGAGACGCCCAGCAGGACTCG
CTACTGCCCGTCATTCACCCGCCGCAGATCCATCTCGGCGGTGAATTTGGCGACACGTCCAACATCACGTTCCGT
TGGGATCCGCCCGTCGGGAGTCAATACGACGGCATGAGCGTGCTGGTCAACGACGTGGAGCGGTTCCGCACCTAT
TTTGGCGACGCCGGCGAGAAGAGCGACTTTCTCTGGTCCCGTAACTCGACGCTGGGTCTTGCCGAGTATTTCAGA
TTCGCCTTCATGACGGGAAGCGACAGCAATGACTACACAAAGGCCGGCACCTGGACGGCCGACGGGCAGTGGAGG
GACATGGCGGCCGGACCGTCTAGTGTGGAAGCAGAGGCTGCGTCATCGTTG
Transcript >Ophio5|7846
ATGGCCAGCCGCTATCATGACGGCGACGACTACGACGACGACGACGACGGCGGCGGCGAGTCTCAGGCCCTTATG
ACAGGGATGGATCAAGGTGAAGCCGACGCCCACGACGGGGCCGTTCCTCCCGTCGTGGACCATCCGGATCAGCCC
CTCGACACGTCGCTCCAGATCCAAGACGACGACCGTCCGCCCACGCCGCGCTTCATTCAGGACGAGCAGGCTTGG
AAGCGATGGAAATGGGTTCCTTATCCCGTGCGCCGTGTCGCCAAGGTCGTGGCAAGGTGGTCAATCGGACCCCCC
GATCCCAGGCCATATCGCATCCGACCTGTCTTCCCCGCCATCCAGCATCTCCCTTTGAATCTTGTCGATCGCTTT
CTGCCCCAGCGCCTGTACCGCGTCTGGCTCCTGATGGTCTACTTTTCCATATGGCTCGTCGCCTTCGCCCTCGTC
AAGCGCAAAGGCAACATGGCTACTGAGGTGGCCGGCTGGGGACAGCCCCAGACCATCGGTTGCGGCGCTTCATAC
TGGGGCGCCGGCAACTATTGCGGCCTCGACGGCTCCCAGTGCCGACCCTTTACCGACAGCGGCTTCGCCTTCCGC
TGCTCCAGCAGCTGCGCGAGCTACATGGTCCTGAACCCGAGGGCTGTCGGCGACCAAGAGATCATCTATAGCCCG
CTCGTCATTGGCGGTCCCTCCAACGACGTGCGGCCAGAGCAGGCCACTTATCGTGGTGACTCGTACATCTGCGCC
GCCGCCATTCACGCCGGAATCATCTCCAACCAGATGGGCGGCTGCGGCGTCGTCAACCTCGTCGGCCGGCAGCAG
GGCTTCGTCAGTTCGCAGCGGAACGGCATCACCAGCACCGGCTTCGATTCCTACTTTCCCCTTTCCTTTCAGTTC
CTCCCTGGCCTCAGCTGCTCCTCGGACGACTCGCGCTGGTCCCTTCTGGCCGTGTCTGCCGTCTTCACCACGTTG
CTTTCTCTCTTCACCGCCTCCCCGGCACTCTTCTTCTTTCCCACCTTTATTGGCCTCTTTTGGACCGTCGGCATG
GCGCTGGATCCGCCGCCGCAGCCGACGGTCACTGCCCTCTTTTCCAACGTCCTCGGCAAGTTCCTCCCGGCCATG
TTCATAGCCTGGGTCATGTACGATCGGATGGGCGTCCGGCGCACGCTCAAGGACCTGACGGCGCAGGTGGAGAAG
ACGATCCTCTGGCTCGGGGCTTGCTGGGTCGGGGCCATGACCAACCACACGCTCGGCTTCATCCCGATCCAGCGG
CTCAACTCGCATGATCTCAACCAGCAGCCGGGCGCCAAGGCGGCACTGGCAATCATTGTCATGGTCCTCACCGTC
GTCGCCGCCTCGCAGATCTGGTTCTTCAGGAAAGAGGGCCGACTGGTCAAGTACCTCAAGCTCTACGCCATCTTC
TTGGCTGCCATCCTCGTCGCCCTCGGCCTTCCAGGGCTCAACCTACGTCTCCATCACTACATCACTGCTCTCGTG
CTGCTGCCGGGGACCAGCATGCAGATGAGGCCTTCTCTGCTGTATCAGGGCCTCCTCGTCGGCCTCTTCATCAAC
GGCGTCGCCCGTTGGGGGTTCGATTCCGTGCTGCAGACGCCGCAGTCGCTGCAGGGAGACGCCCAGCAGGACTCG
CTACTGCCCGTCATTCACCCGCCGCAGATCCATCTCGGCGGTGAATTTGGCGACACGTCCAACATCACGTTCCGT
TGGGATCCGCCCGTCGGGAGTCAATACGACGGCATGAGCGTGCTGGTCAACGACGTGGAGCGGTTCCGCACCTAT
TTTGGCGACGCCGGCGAGAAGAGCGACTTTCTCTGGTCCCGTAACTCGACGCTGGGTCTTGCCGAGTATTTCAGA
TTCGCCTTCATGACGGGAAGCGACAGCAATGACTACACAAAGGCCGGCACCTGGACGGCCGACGGGCAGTGGAGG
GACATGGCGGCCGGACCGTCTAGTGTGGAAGCAGAGGCTGCGTCATCGTTGTAA
Gene >Ophio5|7846
ATGGCCAGCCGCTATCATGACGGCGACGACTACGACGACGACGACGACGGCGGCGGCGAGTCTCAGGCCCTTATG
ACAGGGATGGATCAAGGTGAAGCCGACGCCCACGACGGGGCCGTTCCTCCCGTCGTGGACCATCCGGATCAGCCC
CTCGACACGTCGCTCCAGATCCAAGACGACGACCGTCCGCCCACGCCGCGCTTCATTCAGGACGAGCAGGCTTGG
AAGCGATGGAAATGGGTTCCTTATCCCGTGCGCCGTGTCGCCAAGGTCGTGGCAAGGTGGTCAATCGGACCCCCC
GATCCCAGGCCATATCGCATCCGACCTGTCTTCCCCGCCATCCAGCATCTCCCTTTGAATCTTGTCGATCGCTTT
CTGCCCCAGCGCCTGTACCGCGTCTGGCTCCTGATGGTCTACTTTTCCATATGGCTCGTCGCCTTCGCCCTCGTC
AAGCGCAAAGGCAACATGGCTACTGAGGTGGCCGGCTGGGGACAGCCCCAGACCATCGGTTGCGGCGCTTCATAC
TGGGGCGCCGGCAACTATTGCGGCCTCGACGGCTCCCAGTGCCGACCCTTTACCGACAGCGGCTTCGCCTTCCGC
TGCTCCAGCAGCTGCGCGAGCTACATGGTCCTGAACCCGAGGGCTGTCGGCGACCAAGAGATCATCTATAGCCCG
CTCGTCATTGGCGGTCCCTCCAACGACGTGCGGCCAGAGCAGGCCACTTATCGTGGTGACTCGTACATCTGCGCC
GCCGCCATTCACGCCGGAATCATCTCCAACCAGATGGGCGGCTGCGGCGTCGTCAACCTCGTCGGCCGGCAGCAG
GGCTTCGTCAGTTCGCAGCGGAACGGCATCACCAGCACCGGCTTCGATTCCTACTTTCCCCTTTCCTTTCAGTTC
CTCCCTGGCCTCAGCTGCTCCTCGGACGACTCGCGCTGGTCCCTTCTGGCCGTGTCTGCCGTCTTCACCACGTTG
CTTTCTCTCTTCACCGCCTCCCCGGCACTCTTCTTCTTTCCCACCTTTATTGGCCTCTTTTGGACCGTCGGCATG
GCGCTGGATCCGCCGCCGCAGCCGACGGTCACTGCCCTCTTTTCCAACGTCCTCGGCAAGTTCCTCCCGGCCATG
TTCATAGCCTGGGTCATGTACGATCGGATGGGCGTCCGGCGCACGCTCAAGGACCTGACGGCGCAGGTGGAGAAG
ACGATCCTCTGGCTCGGGGCTTGCTGGGTCGGGGCCATGACCAACCACACGCTCGGCTTCATCCCGATCCAGCGG
CTCAACTCGCATGATCTCAACCAGCAGCCGGGCGCCAAGGCGGCACTGGCAATCATTGTCATGGTCCTCACCGTC
GTCGCCGCCTCGCAGATCTGGTTCTTCAGGAAAGAGGGCCGACTGGTCAAGTACCTCAAGCTCTACGCCATCTTC
TTGGCTGCCATCCTCGTCGCCCTCGGCCTTCCAGGGCTCAACCTACGTCTCCATCACTACATCACTGCTCTCGTG
CTGCTGCCGGGGACCAGCATGCAGATGAGGCCTTCTCTGCTGTATCAGGGCCTCCTCGTCGGCCTCTTCATCAAC
GGCGTCGCCCGTTGGGGGTTCGATTCCGTGCTGCAGACGCCGCAGTCGCTGCAGGGAGACGCCCAGCAGGACTCG
CTACTGCCCGTCATTCACCCGCCGCAGATCCATCTCGGCGGTGAATTTGGCGACACGTCCAACATCACGTTCCGT
TGGGATCCGCCCGTCGGGAGTCAATACGACGGCATGAGCGTGCTGGTCAACGACGTGGAGCGGTTCCGCACCTAT
TTTGGCGACGCCGGCGAGAAGAGCGACTTTCTCTGGTCCCGTAACTCGACGCTGGGTCTTGCCGAGTATTTCAGA
TTCGCCTTCATGACGGGAAGCGACAGCAATGACTACACAAAGGCCGGCACCTGGACGGCCGACGGGCAGTGGAGG
GACATGGCGGCCGGACCGTCTAGTGTGGAAGCAGAGGCTGCGTCATCGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail