Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7832
Gene name
Locationscaffold_80:3910..5151
Strand-
Gene length (bp)1241
Transcript length (bp)951
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 6.3E-20 134 271

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q91Z98|CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus GN=Chil4 PE=1 SV=2 138 226 2.0E-06

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 267 289 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7832
MSPDGGRSLRFAILYFVLLVSFSSRLYYARPASGVNSVTDSVHSFCPSDCRELCTSPSACRHGSADNDLAVAPKD
GRQGAPNDSPSSACGGGSQAVRPNVDSSLTALSPDAGNFEFSIGYSVMRNICCNRTDQEGPLTHLNFAFVSFRQD
YKLTTKNRDFLSRSGLIKARHRHIKTVISIKGWASEGSLPSASWSYITRNWHSRQTFIKSVVEIVNEYDLDGVDF
DCVNTPVISGERESSDADNFVSLLADLHELSNARNSTRTISITILASIFLGLPLFLCICIGPIANMVMSIAGSFD
ATRASNRSNRYFRFFL
Coding >Ophio5|7832
ATGTCGCCTGATGGCGGAAGATCTCTGCGTTTTGCTATTCTCTACTTTGTTCTCCTGGTGTCTTTTTCCTCACGA
CTGTATTATGCTCGTCCCGCCTCTGGCGTGAACTCCGTAACAGATTCGGTTCATTCTTTCTGTCCCTCGGATTGC
CGTGAGCTATGCACTTCGCCATCTGCTTGCCGTCACGGTAGTGCGGACAATGATCTGGCTGTCGCGCCCAAAGAT
GGCAGGCAAGGGGCACCGAATGATTCGCCGTCAAGCGCTTGCGGTGGGGGCTCTCAAGCTGTGAGACCCAATGTT
GATTCCTCACTAACTGCCTTAAGCCCTGACGCAGGGAACTTCGAGTTTAGTATCGGCTACTCCGTCATGAGGAAC
ATTTGTTGCAACCGTACCGATCAAGAAGGGCCGCTTACGCACCTGAATTTCGCGTTTGTGAGTTTCCGTCAAGAC
TACAAGCTCACGACAAAAAACCGGGATTTTCTGTCTCGCTCTGGTCTGATAAAGGCCCGACACCGTCATATCAAA
ACCGTTATTTCAATCAAGGGCTGGGCTTCTGAAGGCAGTCTTCCTTCCGCCTCTTGGTCATACATTACGCGCAAC
TGGCATAGCCGACAGACATTCATCAAGTCCGTTGTCGAGATTGTCAACGAATATGATCTTGACGGTGTCGATTTC
GACTGTGTCAACACTCCGGTCATTTCGGGAGAAAGAGAAAGCTCTGATGCGGACAATTTTGTCTCCCTTCTCGCC
GATCTACACGAGCTGTCTAATGCGCGAAATTCTACAAGGACTATCTCCATAACTATACTCGCGAGTATCTTTCTT
GGTTTACCCTTATTCCTTTGCATCTGCATTGGCCCGATCGCAAACATGGTGATGAGCATAGCCGGCTCATTCGAT
GCAACAAGAGCCTCGAACAGATCAAACCGGTACTTCAGGTTCTTTCTT
Transcript >Ophio5|7832
ATGTCGCCTGATGGCGGAAGATCTCTGCGTTTTGCTATTCTCTACTTTGTTCTCCTGGTGTCTTTTTCCTCACGA
CTGTATTATGCTCGTCCCGCCTCTGGCGTGAACTCCGTAACAGATTCGGTTCATTCTTTCTGTCCCTCGGATTGC
CGTGAGCTATGCACTTCGCCATCTGCTTGCCGTCACGGTAGTGCGGACAATGATCTGGCTGTCGCGCCCAAAGAT
GGCAGGCAAGGGGCACCGAATGATTCGCCGTCAAGCGCTTGCGGTGGGGGCTCTCAAGCTGTGAGACCCAATGTT
GATTCCTCACTAACTGCCTTAAGCCCTGACGCAGGGAACTTCGAGTTTAGTATCGGCTACTCCGTCATGAGGAAC
ATTTGTTGCAACCGTACCGATCAAGAAGGGCCGCTTACGCACCTGAATTTCGCGTTTGTGAGTTTCCGTCAAGAC
TACAAGCTCACGACAAAAAACCGGGATTTTCTGTCTCGCTCTGGTCTGATAAAGGCCCGACACCGTCATATCAAA
ACCGTTATTTCAATCAAGGGCTGGGCTTCTGAAGGCAGTCTTCCTTCCGCCTCTTGGTCATACATTACGCGCAAC
TGGCATAGCCGACAGACATTCATCAAGTCCGTTGTCGAGATTGTCAACGAATATGATCTTGACGGTGTCGATTTC
GACTGTGTCAACACTCCGGTCATTTCGGGAGAAAGAGAAAGCTCTGATGCGGACAATTTTGTCTCCCTTCTCGCC
GATCTACACGAGCTGTCTAATGCGCGAAATTCTACAAGGACTATCTCCATAACTATACTCGCGAGTATCTTTCTT
GGTTTACCCTTATTCCTTTGCATCTGCATTGGCCCGATCGCAAACATGGTGATGAGCATAGCCGGCTCATTCGAT
GCAACAAGAGCCTCGAACAGATCAAACCGGTACTTCAGGTTCTTTCTTTGA
Gene >Ophio5|7832
ATGTCGCCTGATGGCGGAAGATCTCTGCGTTTTGCTATTCTCTACTTTGTTCTCCTGGTGTCTTTTTCCTCACGA
CTGTATTATGCTCGTCCCGCCTCTGGCGTGAACTCCGTAACAGATTCGGTTCATTCTTTCTGTCCCTCGGATTGC
CGTGAGCTATGCACTTCGCCATCTGCTTGCCGTCACGGTAGTGCGGACAATGATCTGGCTGTCGCGCCCAAAGAT
GGCAGGCAAGGGGCACCGAATGATTCGCCGTCAAGCGCTTGCGGTGGGGGCTCTCAAGCTGTGAGACCCAATGTT
GATTCCTCACTGTGAGAGCACGATCATATAAAAGCGATTTGGCACGTATGGACTGATCAAGAACTGCCTTAAGCC
CTGACGCAGGGAACTTCGAGTTTAGTATCGGCTACTCCGTCATGAGGAACATTTGTTGCAACCGTACCGATCAAG
AAGGGCCGCTTACGCACCTGAATTTCGCGTTTGTGAGTTTCCGTCAAGACTACAAGCTCACGACAAAAAACCGGG
ATTTTCTGTCTCGCTCTGGTCTGATAAAGGCCCGACACCGTCATATCAAAACCGTTATTTCAATCAAGGGCTGGG
CTTCTGAAGGCAGTCTTCCTTCCGCCTCTTGGTCATACAGTATGCCGTGAGCCTTCAACGAGCAATTACGGTGAC
TGATTCAGCATAGTTACGCGCAACTGGCATAGCCGACAGACATTCATCAAGTCCGTTGTCGAGATTGTCAACGAA
TATGATCTTGACGGTGTCGATTTCGGTAGGCAGCTAACTATGATGCTTCCCTTGGGGTGTAATTATAAATGACGC
TAACCGAGAATGAACGCGATGTAAGACTGTGTCAACACTCCGGTCATTTCGGGAGAAAGAGAAAGCTCTGATGCG
GACAATTTTGTCTCCCTTCTCGCCGATCTACACGAGCTGTCTAATGCGCGAAATTCTACAAGGACTATCTCCATA
ACTATACTCGCGAGTAGTACACAACTTAAACAGTTTCGCATAAGGAGCATAGAAAGGTATCTTTCTTGGTTTACC
CTTATTCCTTTGCATCTGGTGAGTCTCCCCGAGGCAGACAAGCAGCTTGAACCGGTACGTGACCATGAGCACTGA
CAGGACAGAATTGTAGCATTGGCCCGATCGCAAACATGGTGATGAGCATAGCCGGCTCATTCGATGCAACAAGAG
CCTCGAACAGATCAAACCGGTACTTCAGGTTCTTTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail