Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7823
Gene name
Locationscaffold_8:75030..76203
Strand-
Gene length (bp)1173
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03820 SFXNs Sideroflexins 2.6E-125 11 353

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13793|FSF1_SCHPO Probable mitochondrial transport protein fsf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fsf1 PE=3 SV=2 8 353 3.0E-121
sp|Q12029|FSF1_YEAST Probable mitochondrial transport protein FSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSF1 PE=1 SV=1 1 353 3.0E-114
sp|Q54NQ9|SFXN_DICDI Sideroflexin OS=Dictyostelium discoideum GN=sfxn PE=3 SV=1 8 353 7.0E-71
sp|Q925N0|SFXN5_MOUSE Sideroflexin-5 OS=Mus musculus GN=Sfxn5 PE=1 SV=2 15 353 1.0E-60
sp|Q8CFD0|SFXN5_RAT Sideroflexin-5 OS=Rattus norvegicus GN=Sfxn5 PE=2 SV=1 15 353 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13793|FSF1_SCHPO Probable mitochondrial transport protein fsf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fsf1 PE=3 SV=2 8 353 3.0E-121
sp|Q12029|FSF1_YEAST Probable mitochondrial transport protein FSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSF1 PE=1 SV=1 1 353 3.0E-114
sp|Q54NQ9|SFXN_DICDI Sideroflexin OS=Dictyostelium discoideum GN=sfxn PE=3 SV=1 8 353 7.0E-71
sp|Q925N0|SFXN5_MOUSE Sideroflexin-5 OS=Mus musculus GN=Sfxn5 PE=1 SV=2 15 353 1.0E-60
sp|Q8CFD0|SFXN5_RAT Sideroflexin-5 OS=Rattus norvegicus GN=Sfxn5 PE=2 SV=1 15 353 1.0E-60
sp|Q8TD22|SFXN5_HUMAN Sideroflexin-5 OS=Homo sapiens GN=SFXN5 PE=1 SV=1 15 353 4.0E-60
sp|B2LU20|SFXN1_SHEEP Sideroflexin-1 OS=Ovis aries GN=SFXN1 PE=2 SV=1 1 353 2.0E-52
sp|Q5E9M8|SFXN1_BOVIN Sideroflexin-1 OS=Bos taurus GN=SFXN1 PE=2 SV=3 1 353 5.0E-51
sp|Q9H9B4|SFXN1_HUMAN Sideroflexin-1 OS=Homo sapiens GN=SFXN1 PE=1 SV=4 1 353 1.0E-50
sp|A5A761|SFXN1_PIG Sideroflexin-1 OS=Sus scrofa GN=SFXN1 PE=2 SV=1 1 353 3.0E-50
sp|Q5RD16|SFXN3_PONAB Sideroflexin-3 OS=Pongo abelii GN=SFXN3 PE=2 SV=1 4 353 5.0E-50
sp|Q9BWM7|SFXN3_HUMAN Sideroflexin-3 OS=Homo sapiens GN=SFXN3 PE=1 SV=2 4 353 2.0E-49
sp|Q9JHY2|SFXN3_RAT Sideroflexin-3 OS=Rattus norvegicus GN=Sfxn3 PE=2 SV=1 4 353 8.0E-49
sp|Q99JR1|SFXN1_MOUSE Sideroflexin-1 OS=Mus musculus GN=Sfxn1 PE=1 SV=3 1 353 1.0E-48
sp|A6QP55|SFXN3_BOVIN Sideroflexin-3 OS=Bos taurus GN=SFXN3 PE=2 SV=1 4 353 1.0E-48
sp|Q91V61|SFXN3_MOUSE Sideroflexin-3 OS=Mus musculus GN=Sfxn3 PE=1 SV=1 4 353 2.0E-48
sp|Q63965|SFXN1_RAT Sideroflexin-1 OS=Rattus norvegicus GN=Sfxn1 PE=2 SV=4 1 353 8.0E-48
sp|Q5FC79|SFXN5_CAEEL Sideroflexin-5 OS=Caenorhabditis elegans GN=sfxn-5 PE=3 SV=1 15 353 6.0E-45
sp|Q09201|SFXN1_CAEEL Putative sideroflexin-1.1 OS=Caenorhabditis elegans GN=sfxn-1.1 PE=3 SV=1 15 353 3.0E-42
sp|Q925N2|SFXN2_MOUSE Sideroflexin-2 OS=Mus musculus GN=Sfxn2 PE=1 SV=1 15 353 1.0E-34
sp|Q96NB2|SFXN2_HUMAN Sideroflexin-2 OS=Homo sapiens GN=SFXN2 PE=1 SV=2 15 353 4.0E-34
sp|Q5EA43|SFXN2_BOVIN Sideroflexin-2 OS=Bos taurus GN=SFXN2 PE=2 SV=2 15 353 4.0E-34
sp|A8E7G5|SFXN4_DANRE Sideroflexin-4 OS=Danio rerio GN=sfxn4 PE=2 SV=1 15 353 3.0E-12
sp|Q3T0M2|SFXN4_BOVIN Sideroflexin-4 OS=Bos taurus GN=SFXN4 PE=2 SV=1 20 353 2.0E-09
sp|Q925N1|SFXN4_MOUSE Sideroflexin-4 OS=Mus musculus GN=Sfxn4 PE=2 SV=2 20 353 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006811 ion transport Yes
GO:0016020 membrane Yes
GO:0015075 ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 300 322 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 62.59 33.50 91.67
CcL In ants, during behavior modification 128.67 60.47 196.86
CcD In ants, recently dead 107.52 58.26 156.78

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001437 yes
SC16a CcD 0.013421 yes
CcL CcD 0.506668 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7823
MSSSLPGSRELPVSQYDLSSYWGRVRHAVGITDPSTLFAGKAGLEKAKRLVTDYKTGRTQYMTPELWQAKKIVDS
TLHPDTGEPVFLPLRMSCFVITNLIVTAGMLQPGLQTAGTVAWQVANQSVNVAVNSANANKSSPMTTTMLAKSYV
FAVTASCSVALGLNRLVPRLRVSAGTRNVLGRLVPFAAVASAGALNAYLMRRGEIQTGIDVRPVLSSEEKKRLQE
QGKSERDVPSLGKSRKAAKLAVYETAASRVFNSSPVMVLPPMVLYYMQHKQAWYKRLMERNWVKARPRMAATIPI
GINLGLIAATAFAVLPLALAVFPQQQQISADRLEDEFHGRGGSDGKVWFNRGL
Coding >Ophio5|7823
ATGTCGTCGTCGCTACCGGGCTCGCGCGAGCTGCCTGTTTCGCAATATGACTTGAGCAGCTACTGGGGCCGGGTG
CGGCACGCGGTCGGCATCACCGATCCAAGCACCCTCTTTGCTGGCAAGGCCGGGCTCGAAAAGGCAAAGAGGCTC
GTCACTGACTACAAGACGGGAAGGACGCAATACATGACGCCGGAGCTGTGGCAGGCCAAGAAAATTGTCGACTCG
ACGCTCCATCCAGACACGGGCGAACCCGTCTTTCTGCCTCTTCGCATGTCCTGTTTTGTCATCACCAACCTCATC
GTGACGGCGGGCATGCTGCAGCCCGGGTTGCAGACGGCCGGCACGGTGGCTTGGCAGGTGGCCAACCAATCGGTC
AACGTGGCCGTCAATAGCGCAAACGCCAACAAGTCGTCGCCCATGACGACGACGATGCTGGCCAAGTCCTACGTA
TTCGCCGTCACGGCCTCGTGCTCCGTCGCTCTCGGCCTGAACCGGCTTGTGCCCCGGCTGCGGGTCTCGGCCGGC
ACTCGCAACGTCCTCGGCCGGCTCGTGCCCTTTGCCGCCGTTGCCTCAGCCGGCGCGCTCAACGCCTATCTGATG
CGTCGCGGCGAGATTCAGACGGGCATCGACGTTCGACCGGTGCTCTCATCCGAGGAGAAGAAACGGCTGCAGGAG
CAGGGCAAGTCAGAGCGAGACGTGCCGTCGCTGGGCAAGAGCCGCAAGGCGGCCAAGCTGGCCGTGTATGAGACG
GCAGCCAGCCGAGTCTTCAATAGCAGCCCCGTCATGGTGCTGCCGCCCATGGTGCTCTACTACATGCAGCACAAG
CAGGCCTGGTACAAGAGGCTGATGGAGAGGAACTGGGTCAAGGCCAGGCCCAGGATGGCGGCGACAATTCCCATT
GGCATCAACCTCGGGCTGATTGCGGCGACTGCGTTTGCTGTACTGCCGCTGGCGCTTGCTGTCTTCCCGCAGCAG
CAGCAGATATCGGCCGACAGGCTCGAGGACGAGTTCCATGGCCGAGGCGGCAGCGACGGCAAGGTGTGGTTTAAT
CGCGGCCTC
Transcript >Ophio5|7823
ATGTCGTCGTCGCTACCGGGCTCGCGCGAGCTGCCTGTTTCGCAATATGACTTGAGCAGCTACTGGGGCCGGGTG
CGGCACGCGGTCGGCATCACCGATCCAAGCACCCTCTTTGCTGGCAAGGCCGGGCTCGAAAAGGCAAAGAGGCTC
GTCACTGACTACAAGACGGGAAGGACGCAATACATGACGCCGGAGCTGTGGCAGGCCAAGAAAATTGTCGACTCG
ACGCTCCATCCAGACACGGGCGAACCCGTCTTTCTGCCTCTTCGCATGTCCTGTTTTGTCATCACCAACCTCATC
GTGACGGCGGGCATGCTGCAGCCCGGGTTGCAGACGGCCGGCACGGTGGCTTGGCAGGTGGCCAACCAATCGGTC
AACGTGGCCGTCAATAGCGCAAACGCCAACAAGTCGTCGCCCATGACGACGACGATGCTGGCCAAGTCCTACGTA
TTCGCCGTCACGGCCTCGTGCTCCGTCGCTCTCGGCCTGAACCGGCTTGTGCCCCGGCTGCGGGTCTCGGCCGGC
ACTCGCAACGTCCTCGGCCGGCTCGTGCCCTTTGCCGCCGTTGCCTCAGCCGGCGCGCTCAACGCCTATCTGATG
CGTCGCGGCGAGATTCAGACGGGCATCGACGTTCGACCGGTGCTCTCATCCGAGGAGAAGAAACGGCTGCAGGAG
CAGGGCAAGTCAGAGCGAGACGTGCCGTCGCTGGGCAAGAGCCGCAAGGCGGCCAAGCTGGCCGTGTATGAGACG
GCAGCCAGCCGAGTCTTCAATAGCAGCCCCGTCATGGTGCTGCCGCCCATGGTGCTCTACTACATGCAGCACAAG
CAGGCCTGGTACAAGAGGCTGATGGAGAGGAACTGGGTCAAGGCCAGGCCCAGGATGGCGGCGACAATTCCCATT
GGCATCAACCTCGGGCTGATTGCGGCGACTGCGTTTGCTGTACTGCCGCTGGCGCTTGCTGTCTTCCCGCAGCAG
CAGCAGATATCGGCCGACAGGCTCGAGGACGAGTTCCATGGCCGAGGCGGCAGCGACGGCAAGGTGTGGTTTAAT
CGCGGCCTCTAA
Gene >Ophio5|7823
ATGTCGTCGTCGCTACCGGGCTCGCGCGAGCTGCCTGTTTCGCAATATGACTTGAGCAGCTACTGGGGCCGGGTG
CGGCACGCGGTCGGCATCACCGATCCAAGGTGAGCTTCGCCAGCCGAAGCTCGACGGCGGCGCTGACTTGGGGCT
CGTCTAGCACCCTCTTTGCTGGCAAGGCCGGGCTCGAAAAGGCAAAGAGGCTCGTCACTGACTACAAGACGGGAA
GGACGCAATACATGACGCCGGAGCTGTGGCAGGCCAAGAAAATTGTCGACTCGACGCTCCATCCAGGTTTGCTCT
TCCCTTGGGACTGTCGAGCGGGCGGCCAGCTGAAGACATTGGTTACCAGACACGGGCGAACCCGTCTTTCTGCCT
CTTCGCATGTCCTGTTTTGTCATCACCAACCTCATCGTGACGGCGGGCATGCTGCAGCCCGGGTTGCAGACGGCC
GGCACGGTGGCTTGGCAGGTGGCCAACCAATCGGTCAACGTGGCCGTCAATAGCGCAAACGCCAACAAGTCGTCG
CCCATGACGACGACGATGCTGGCCAAGTCCTACGTATTCGCCGTCACGGCCTCGTGCTCCGTCGCTCTCGGCCTG
AACCGGCTTGTGCCCCGGCTGCGGGTCTCGGCCGGCACTCGCAACGTCCTCGGCCGGCTCGTGCCCTTTGCCGCC
GTTGCCTCAGCCGGCGCGCTCAACGCCTATCTGATGCGTCGCGGCGAGATTCAGACGGGCATCGACGTTCGACCG
GTGCTCTCATCCGAGGAGAAGAAACGGCTGCAGGAGCAGGGCAAGTCAGAGCGAGACGTGCCGTCGCTGGGCAAG
AGCCGCAAGGCGGCCAAGCTGGCCGTGTATGAGACGGCAGCCAGCCGAGTCTTCAATAGCAGCCCCGTCATGGTG
CTGCCGCCCATGGTGCTCTACTACATGCAGCACAAGCAGGCCTGGTACAAGAGGCTGATGGAGAGGAACTGGGTC
AAGGCCAGGCCCAGGATGGCGGCGACAATTCCCATTGGCATCAACCTCGGGCTGATTGCGGCGACTGCGTTTGCT
GTACTGCCGCTGGCGCTTGCTGTCTTCCCGCAGCAGCAGCAGATATCGGCCGACAGGCTCGAGGACGAGTTCCAT
GGCCGAGGCGGCAGCGACGGCAAGGTGTGGTTTAATCGCGGCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail