Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7806
Gene name
Locationscaffold_8:30103..32890
Strand-
Gene length (bp)2787
Transcript length (bp)2634
Coding sequence length (bp)2631
Protein length (aa) 877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 3.7E-155 165 827

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 65 851 5.0E-149
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 144 848 5.0E-135
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 125 842 1.0E-125
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 123 871 3.0E-125
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 142 840 3.0E-121
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 65 851 5.0E-149
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 144 848 5.0E-135
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 125 842 1.0E-125
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 123 871 3.0E-125
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 142 840 3.0E-121
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 123 839 2.0E-120
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 1 849 8.0E-119
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 130 857 4.0E-118
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 148 861 7.0E-112
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 142 839 7.0E-112
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 103 866 9.0E-112
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 148 857 2.0E-110
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 121 858 2.0E-99
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 70 851 9.0E-84
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 166 188 22
2 193 215 22
3 241 263 22
4 278 300 22
5 343 362 19
6 377 399 22
7 412 434 22
8 491 513 22
9 551 573 22
10 578 600 22
11 607 629 22
12 659 681 22
13 728 750 22
14 770 792 22
15 805 827 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7806
MAPVEREKKDGHDEDGEPKSTATETMIDDNEKENPRVAATENKNDEEEKEKPQVAAMEQKVTEGQEDEKQELQED
STESLSEEALTASLQELLEKHELDQNFPSHLLNGARDFLRRRQAGERTEDGHQLMASFNEYSELVRNSSPYMEVR
AVVDVTDDPSIPVGTFRVFLLGTFFSAAGSAMHQFFSLRLPGISISTFVVQLLAMPLGVAMARWLPKNRRLGYGR
FTFNLNPGDFSQKEHLLIAMMANVSLGSPYVVAIVQVLKLDLFYGEKVLSHSIPWQMLTLVSTQLLGYGCAGLTR
RFLVYPPSMIWPRTLATLALTKALRRESGPSSWKLTEMTRYRFFMVAFAAMFVWFWIPNYFFESLRLFNWPTWFS
PGNTTLALVVGSTCGLGLFNVLPTFDWNTATSLGDPIVTPLFTLLNFAAGMALSALIILPMYFGNFMNAGFLPIN
NNKIYDNSAEIYDVQSILTPELTLDEEAYLNYSIPYLSTTLVVQMVAIFVVYVAVPVHVFLYFRRDIAAGLRAAW
SRKPREEEFDDVHNRLMSAYPEVPHWWYGVVLLLSFTLACVSVSAFPTGMPIWGIVVAVSFTMLLQIPIGMLLAI
SNIEVSTSILAFLIAGFAMEGKVLENLIFKMYSFMSTSQSLHFAGDLKLAHYAKIPPRWAFGAQIYATLLGGFVA
LGVNHWSLDNIKDVCQEGQAERFICPHTHSFFVSSVLWGAIGPRRLFGSDGPYRGVLYFLPLGIIIPLAAWYLVR
RWPNSWLRHFNAPIFLAGPVAWAPLNLSYMQGTVALALFFNRYIKNRYPAWWTKYAYVLAASFSAATGVAALFIF
FGLQRWNIKIDWIGNNIASQGVDQGGFLTANGTKLKCANLHLQPGETFASGF
Coding >Ophio5|7806
ATGGCACCAGTGGAGCGGGAGAAGAAAGATGGTCATGACGAGGATGGTGAGCCAAAGTCGACGGCGACGGAAACG
ATGATCGACGATAACGAAAAAGAGAATCCACGGGTGGCGGCAACGGAAAATAAGAATGACGAGGAGGAAAAAGAA
AAGCCACAGGTGGCTGCGATGGAACAGAAAGTTACTGAAGGACAGGAGGACGAGAAGCAAGAGTTGCAGGAAGAC
TCGACAGAATCTCTATCGGAAGAAGCGTTAACCGCATCTTTACAGGAGCTGCTCGAAAAGCACGAGCTCGATCAA
AACTTTCCCAGCCATCTACTGAATGGGGCACGCGACTTCCTCCGCAGGCGGCAGGCAGGCGAGCGTACAGAGGAC
GGCCACCAGCTGATGGCCTCTTTTAACGAATACTCGGAACTTGTTCGAAACAGCAGTCCTTATATGGAAGTTCGT
GCCGTGGTTGATGTCACCGACGATCCTTCAATTCCCGTTGGAACATTCAGGGTTTTCTTGCTTGGAACATTCTTT
TCTGCTGCCGGCAGTGCAATGCACCAATTCTTTTCGCTACGCCTCCCCGGCATCTCCATCTCGACATTTGTGGTG
CAGTTGCTCGCGATGCCGCTCGGGGTTGCCATGGCTCGCTGGTTACCGAAGAACCGAAGATTGGGATACGGCCGG
TTTACCTTCAACTTGAATCCGGGCGATTTCTCGCAAAAGGAGCACTTGCTTATCGCCATGATGGCCAACGTTTCT
CTCGGTAGTCCATACGTGGTTGCCATTGTGCAGGTGTTGAAGCTCGACCTCTTCTATGGCGAGAAAGTGTTGTCT
CATTCGATTCCATGGCAAATGTTGACACTCGTGTCCACACAACTACTAGGCTACGGCTGTGCTGGCTTGACGAGA
CGTTTTCTCGTCTATCCACCGTCGATGATTTGGCCCCGAACATTGGCCACTCTTGCTTTGACCAAGGCCTTGCGG
CGAGAAAGCGGACCTTCGTCTTGGAAACTGACGGAAATGACACGGTACCGATTTTTCATGGTCGCCTTCGCCGCC
ATGTTTGTCTGGTTCTGGATTCCCAACTACTTCTTCGAGAGCCTCAGACTTTTCAACTGGCCAACGTGGTTTTCT
CCCGGCAACACTACCCTGGCTCTGGTTGTCGGCAGCACGTGCGGACTTGGCCTCTTCAACGTTTTGCCTACCTTT
GACTGGAATACGGCTACAAGCTTGGGAGATCCCATCGTCACGCCTTTATTTACGCTTTTGAACTTTGCCGCAGGC
ATGGCCCTTTCTGCTTTGATCATCTTGCCCATGTACTTTGGCAATTTCATGAACGCCGGCTTCTTGCCAATCAAC
AACAACAAGATCTACGACAATTCGGCAGAGATCTACGATGTTCAGAGTATACTGACGCCCGAGCTAACCTTGGAC
GAGGAAGCATACCTGAATTACAGCATACCGTATCTGTCAACAACGCTGGTGGTGCAAATGGTCGCCATCTTCGTC
GTCTACGTCGCCGTGCCCGTACACGTTTTCCTATACTTCAGACGAGACATAGCGGCCGGTCTTCGCGCCGCCTGG
AGTCGGAAACCACGCGAAGAAGAGTTCGACGACGTGCATAACCGGTTAATGTCGGCTTATCCCGAGGTACCCCAT
TGGTGGTACGGAGTGGTTTTGTTGCTATCCTTCACGCTCGCTTGCGTGTCCGTCAGCGCTTTCCCTACTGGCATG
CCCATCTGGGGCATTGTCGTCGCCGTCAGTTTCACGATGCTGCTTCAGATACCCATTGGCATGCTCCTCGCAATA
TCCAACATTGAGGTTTCGACTTCCATCTTGGCCTTTCTCATTGCAGGCTTCGCCATGGAGGGAAAGGTACTCGAG
AATTTGATTTTTAAGATGTATAGCTTTATGTCTACGAGTCAGTCTTTGCACTTTGCCGGGGATCTCAAGCTCGCG
CATTATGCCAAGATCCCACCGCGATGGGCATTCGGGGCGCAGATTTACGCCACACTGTTGGGCGGTTTCGTTGCC
CTCGGCGTCAACCACTGGAGCTTGGACAACATCAAGGATGTGTGCCAGGAGGGGCAAGCCGAGCGATTCATCTGC
CCTCACACCCACTCCTTCTTTGTCAGCTCTGTTCTATGGGGTGCAATCGGGCCAAGACGGCTATTTGGAAGCGAT
GGCCCCTATCGTGGCGTGTTATACTTTTTGCCGCTTGGAATAATCATTCCTTTGGCTGCGTGGTACCTGGTCCGC
CGTTGGCCAAACTCATGGCTTCGTCACTTCAATGCACCCATCTTTCTTGCAGGCCCGGTTGCGTGGGCTCCTCTT
AACCTTTCTTACATGCAGGGAACAGTTGCGCTTGCGTTGTTCTTCAACCGATACATCAAGAACAGATACCCGGCT
TGGTGGACCAAGTACGCATACGTTCTGGCCGCTTCTTTCTCAGCAGCTACCGGCGTCGCCGCCCTGTTCATCTTC
TTCGGCCTGCAGAGGTGGAACATTAAGATTGATTGGATCGGAAATAACATCGCAAGCCAAGGAGTCGATCAAGGC
GGTTTCCTCACCGCAAACGGCACAAAACTGAAATGTGCCAACTTGCACTTGCAGCCTGGAGAGACGTTCGCCTCT
GGTTTT
Transcript >Ophio5|7806
ATGGCACCAGTGGAGCGGGAGAAGAAAGATGGTCATGACGAGGATGGTGAGCCAAAGTCGACGGCGACGGAAACG
ATGATCGACGATAACGAAAAAGAGAATCCACGGGTGGCGGCAACGGAAAATAAGAATGACGAGGAGGAAAAAGAA
AAGCCACAGGTGGCTGCGATGGAACAGAAAGTTACTGAAGGACAGGAGGACGAGAAGCAAGAGTTGCAGGAAGAC
TCGACAGAATCTCTATCGGAAGAAGCGTTAACCGCATCTTTACAGGAGCTGCTCGAAAAGCACGAGCTCGATCAA
AACTTTCCCAGCCATCTACTGAATGGGGCACGCGACTTCCTCCGCAGGCGGCAGGCAGGCGAGCGTACAGAGGAC
GGCCACCAGCTGATGGCCTCTTTTAACGAATACTCGGAACTTGTTCGAAACAGCAGTCCTTATATGGAAGTTCGT
GCCGTGGTTGATGTCACCGACGATCCTTCAATTCCCGTTGGAACATTCAGGGTTTTCTTGCTTGGAACATTCTTT
TCTGCTGCCGGCAGTGCAATGCACCAATTCTTTTCGCTACGCCTCCCCGGCATCTCCATCTCGACATTTGTGGTG
CAGTTGCTCGCGATGCCGCTCGGGGTTGCCATGGCTCGCTGGTTACCGAAGAACCGAAGATTGGGATACGGCCGG
TTTACCTTCAACTTGAATCCGGGCGATTTCTCGCAAAAGGAGCACTTGCTTATCGCCATGATGGCCAACGTTTCT
CTCGGTAGTCCATACGTGGTTGCCATTGTGCAGGTGTTGAAGCTCGACCTCTTCTATGGCGAGAAAGTGTTGTCT
CATTCGATTCCATGGCAAATGTTGACACTCGTGTCCACACAACTACTAGGCTACGGCTGTGCTGGCTTGACGAGA
CGTTTTCTCGTCTATCCACCGTCGATGATTTGGCCCCGAACATTGGCCACTCTTGCTTTGACCAAGGCCTTGCGG
CGAGAAAGCGGACCTTCGTCTTGGAAACTGACGGAAATGACACGGTACCGATTTTTCATGGTCGCCTTCGCCGCC
ATGTTTGTCTGGTTCTGGATTCCCAACTACTTCTTCGAGAGCCTCAGACTTTTCAACTGGCCAACGTGGTTTTCT
CCCGGCAACACTACCCTGGCTCTGGTTGTCGGCAGCACGTGCGGACTTGGCCTCTTCAACGTTTTGCCTACCTTT
GACTGGAATACGGCTACAAGCTTGGGAGATCCCATCGTCACGCCTTTATTTACGCTTTTGAACTTTGCCGCAGGC
ATGGCCCTTTCTGCTTTGATCATCTTGCCCATGTACTTTGGCAATTTCATGAACGCCGGCTTCTTGCCAATCAAC
AACAACAAGATCTACGACAATTCGGCAGAGATCTACGATGTTCAGAGTATACTGACGCCCGAGCTAACCTTGGAC
GAGGAAGCATACCTGAATTACAGCATACCGTATCTGTCAACAACGCTGGTGGTGCAAATGGTCGCCATCTTCGTC
GTCTACGTCGCCGTGCCCGTACACGTTTTCCTATACTTCAGACGAGACATAGCGGCCGGTCTTCGCGCCGCCTGG
AGTCGGAAACCACGCGAAGAAGAGTTCGACGACGTGCATAACCGGTTAATGTCGGCTTATCCCGAGGTACCCCAT
TGGTGGTACGGAGTGGTTTTGTTGCTATCCTTCACGCTCGCTTGCGTGTCCGTCAGCGCTTTCCCTACTGGCATG
CCCATCTGGGGCATTGTCGTCGCCGTCAGTTTCACGATGCTGCTTCAGATACCCATTGGCATGCTCCTCGCAATA
TCCAACATTGAGGTTTCGACTTCCATCTTGGCCTTTCTCATTGCAGGCTTCGCCATGGAGGGAAAGGTACTCGAG
AATTTGATTTTTAAGATGTATAGCTTTATGTCTACGAGTCAGTCTTTGCACTTTGCCGGGGATCTCAAGCTCGCG
CATTATGCCAAGATCCCACCGCGATGGGCATTCGGGGCGCAGATTTACGCCACACTGTTGGGCGGTTTCGTTGCC
CTCGGCGTCAACCACTGGAGCTTGGACAACATCAAGGATGTGTGCCAGGAGGGGCAAGCCGAGCGATTCATCTGC
CCTCACACCCACTCCTTCTTTGTCAGCTCTGTTCTATGGGGTGCAATCGGGCCAAGACGGCTATTTGGAAGCGAT
GGCCCCTATCGTGGCGTGTTATACTTTTTGCCGCTTGGAATAATCATTCCTTTGGCTGCGTGGTACCTGGTCCGC
CGTTGGCCAAACTCATGGCTTCGTCACTTCAATGCACCCATCTTTCTTGCAGGCCCGGTTGCGTGGGCTCCTCTT
AACCTTTCTTACATGCAGGGAACAGTTGCGCTTGCGTTGTTCTTCAACCGATACATCAAGAACAGATACCCGGCT
TGGTGGACCAAGTACGCATACGTTCTGGCCGCTTCTTTCTCAGCAGCTACCGGCGTCGCCGCCCTGTTCATCTTC
TTCGGCCTGCAGAGGTGGAACATTAAGATTGATTGGATCGGAAATAACATCGCAAGCCAAGGAGTCGATCAAGGC
GGTTTCCTCACCGCAAACGGCACAAAACTGAAATGTGCCAACTTGCACTTGCAGCCTGGAGAGACGTTCGCCTCT
GGTTTTTGA
Gene >Ophio5|7806
ATGGCACCAGTGGAGCGGGAGAAGAAAGATGGTCATGACGAGGATGGTGAGCCAAAGTCGACGGCGACGGAAACG
ATGATCGACGATAACGAAAAAGAGAATCCACGGGTGGCGGCAACGGAAAATAAGAATGACGAGGAGGAAAAAGAA
AAGCCACAGGTGGCTGCGATGGAACAGAAAGTTACTGAAGGACAGGAGGACGAGAAGCAAGAGTTGTCAGCGAGA
AATACGCGGCCGAATAGCACGTCGACACTCAGGGGAAAAGAATCCATCTACTCTCTGTCGACACTCAGGCAGGAA
GACTCGACAGAATCTCTATCGGAAGAAGCGTTAACCGCATCTTTACAGGAGCTGCTCGAAAAGCACGAGCTCGAT
CAAAACTTTCCCAGCCATCTACTGAATGGGGCACGCGACTTCCTCCGCAGGCGGCAGGCAGGCGAGCGTACAGAG
GACGGCCACCAGCTGATGGCCTCTTTTAACGAATACTCGGAACTTGTTCGAAACAGCAGTCCTTATATGGAAGTT
CGTGCCGTGGTTGATGTCACCGACGATCCTTCAATTCCCGTTGGAACATTCAGGGTTTTCTTGCTTGGAACATTC
TTTTCTGCTGCCGGCAGTGCAATGCACCAATTCTTTTCGCTACGCCTCCCCGGCATCTCCATCTCGACATTTGTG
GTGCAGTTGCTCGCGATGCCGCTCGGGGTTGCCATGGCTCGCTGGTTACCGAAGAACCGAAGATTGGGATACGGC
CGGTTTACCTTCAACTTGAATCCGGGCGATTTCTCGCAAAAGGAGCACTTGCTTATCGCCATGATGGCCAACGTT
TCTCTCGGTAGTCCATACGTGGTTGCCATTGTGCAGGTGTTGAAGCTCGACCTCTTCTATGGCGAGAAAGTGTTG
TCTCATTCGATTCCATGGCAAATGTTGACACTCGTGTCCACACAACTACTAGGCTACGGCTGTGCTGGCTTGACG
AGACGTTTTCTCGTCTATCCACCGTCGATGATTTGGCCCCGAACATTGGCCACTCTTGCTTTGACCAAGGCCTTG
CGGCGAGAAAGCGGACCTTCGTCTTGGAAACTGACGGAAATGACACGGTACCGATTTTTCATGGTCGCCTTCGCC
GCCATGTTTGTCTGGTTCTGGATTCCCAACTACTTCTTCGAGAGCCTCAGACTTTTCAACTGGCCAACGTGGTTT
TCTCCCGGCAACACTACCCTGGCTCTGGTTGTCGGCAGCACGTGCGGACTTGGCCTCTTCAACGTTTTGCCTACC
TTTGACTGGAATACGGCTACAAGCTTGGGAGATCCCATCGTCACGCCTTTATTTACGCTTTTGAACTTTGCCGCA
GGCATGGCCCTTTCTGCTTTGATCATCTTGCCCATGTACTTTGGCAATTTCATGAACGCCGGCTTCTTGCCAATC
AACAACAACAAGATCTACGACAATTCGGCAGAGATCTACGATGTTCAGAGTATACTGACGCCCGAGCTAACCTTG
GACGAGGAAGCATACCTGAATTACAGCATACCGTATCTGTCAACAACGCTGGTGGTGCAAATGGTCGCCATCTTC
GTCGTCTACGTCGCCGTGCCCGTACACGTTTTCCTATACTTCAGACGAGACATAGCGGCCGGTCTTCGCGCCGCC
TGGAGTCGGAAACCACGCGAAGAAGAGTTCGACGACGTGCATAACCGGTTAATGTCGGCTTATCCCGAGGTACCC
CATTGGTGGTACGGAGTGGTTTTGTTGCTATCCTTCACGCTCGCTTGCGTGTCCGTCAGCGCTTTCCCTACTGGC
ATGCCCATCTGGGGCATTGTCGTCGCCGTCAGTTTCACGATGCTGCTTCAGATACCCATTGGCATGCTCCTCGCA
ATATCCAACATTGAGGTTTCGACTTCCATCTTGGCCTTTCTCATTGCAGGCTTCGCCATGGAGGGAAAGGTACTC
GAGAATTTGATTTTTAAGATGTATAGCTTTATGTCTACGAGGTTCGTTTTTTTTTCACTACCATCGGTCTCAGGA
AATGCCATCGATGTTTTTTTTTTGCTCACACTCACTCACAGTCAGTCTTTGCACTTTGCCGGGGATCTCAAGCTC
GCGCATTATGCCAAGATCCCACCGCGATGGGCATTCGGGGCGCAGATTTACGCCACACTGTTGGGCGGTTTCGTT
GCCCTCGGCGTCAACCACTGGAGCTTGGACAACATCAAGGATGTGTGCCAGGAGGGGCAAGCCGAGCGATTCATC
TGCCCTCACACCCACTCCTTCTTTGTCAGCTCTGTTCTATGGGGTGCAATCGGGCCAAGACGGCTATTTGGAAGC
GATGGCCCCTATCGTGGCGTGTTATACTTTTTGCCGCTTGGAATAATCATTCCTTTGGCTGCGTGGTACCTGGTC
CGCCGTTGGCCAAACTCATGGCTTCGTCACTTCAATGCACCCATCTTTCTTGCAGGCCCGGTTGCGTGGGCTCCT
CTTAACCTTTCTTACATGCAGGGAACAGTTGCGCTTGCGTTGTTCTTCAACCGATACATCAAGAACAGATACCCG
GCTTGGTGGACCAAGTACGCATACGTTCTGGCCGCTTCTTTCTCAGCAGCTACCGGCGTCGCCGCCCTGTTCATC
TTCTTCGGCCTGCAGAGGTGGAACATTAAGATTGATTGGATCGGAAATAACATCGCAAGCCAAGGAGTCGATCAA
GGCGGTTTCCTCACCGCAAACGGCACAAAACTGAAATGTGCCAACTTGCACTTGCAGCCTGGAGAGACGTTCGCC
TCTGGTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail