Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7800
Gene name
Locationscaffold_8:15082..16021
Strand-
Gene length (bp)939
Transcript length (bp)780
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.4E-26 49 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 38 250 3.0E-50
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 5 252 7.0E-47
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 38 241 8.0E-20
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 52 242 1.0E-19
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 26 240 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 38 250 3.0E-50
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 5 252 7.0E-47
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 38 241 8.0E-20
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 52 242 1.0E-19
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 26 240 2.0E-16
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 31 240 6.0E-16
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 52 210 5.0E-14
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 55 210 5.0E-13
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 51 219 6.0E-13
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 52 176 9.0E-13
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 55 210 1.0E-12
sp|P50354|NODB_RHIGA Chitooligosaccharide deacetylase OS=Rhizobium galegae GN=nodB PE=3 SV=1 55 176 1.0E-11
sp|Q52845|NODB_RHILO Chitooligosaccharide deacetylase OS=Rhizobium loti (strain MAFF303099) GN=nodB PE=3 SV=2 52 176 1.0E-11
sp|Q06702|CDA1_YEAST Chitin deacetylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA1 PE=1 SV=1 5 244 5.0E-11
sp|Q8SU65|YB51_ENCCU Polysaccharide deacetylase domain-containing protein ECU11_0510 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_0510 PE=1 SV=1 46 241 6.0E-11
sp|P24150|NODB_RHILP Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. phaseoli GN=nodB PE=3 SV=1 52 176 2.0E-10
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 44 242 3.0E-10
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 55 210 5.0E-10
sp|O07596|YHEN_BACSU Putative polysaccharide deacetylase YheN OS=Bacillus subtilis (strain 168) GN=yheN PE=3 SV=1 52 231 6.0E-09
sp|Q07740|NODB_AZOC5 Chitooligosaccharide deacetylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodB PE=3 SV=2 46 177 7.0E-09
sp|P50850|YLXY_BACSU Uncharacterized protein YlxY OS=Bacillus subtilis (strain 168) GN=ylxY PE=3 SV=2 64 245 1.0E-07
sp|P82476|CDA_CRYNH Chitin deacetylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01239 PE=1 SV=3 54 216 1.0E-07
sp|P0CP76|CDA_CRYNJ Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MP 84 PE=2 SV=1 54 216 2.0E-07
sp|P0CP77|CDA_CRYNB Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MP 84 PE=3 SV=1 54 216 3.0E-07
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 51 222 2.0E-06
sp|P94361|YXKH_BACSU Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) GN=yxkH PE=3 SV=1 55 166 2.0E-06
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 53 183 4.0E-06
sp|Q99PX1|DEAA_VIBAL Chitin disaccharide deacetylase OS=Vibrio alginolyticus GN=deaA PE=1 SV=1 1 118 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1106 0.0488 0.9323 0.0597 0.0745 0.0274 0.1681 0.2827 0.1727 0.0084

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999776

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE4 4.2E-29 49 169

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup88
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3130
Ophiocordyceps australis 1348a (Ghana) OphauG2|438
Ophiocordyceps australis map64 (Brazil) OphauB2|1465
Ophiocordyceps australis map64 (Brazil) OphauB2|230
Ophiocordyceps camponoti-floridani Ophcf2|03614
Ophiocordyceps camponoti-floridani Ophcf2|06957
Ophiocordyceps camponoti-floridani Ophcf2|05927
Ophiocordyceps camponoti-rufipedis Ophun1|481
Ophiocordyceps camponoti-rufipedis Ophun1|6139
Ophiocordyceps camponoti-rufipedis Ophun1|5221
Ophiocordyceps kimflemingae Ophio5|24
Ophiocordyceps kimflemingae Ophio5|7553
Ophiocordyceps kimflemingae Ophio5|7800 (this protein)
Ophiocordyceps subramaniannii Hirsu2|960
Ophiocordyceps subramaniannii Hirsu2|5438
Ophiocordyceps subramaniannii Hirsu2|3901
Ophiocordyceps subramaniannii Hirsu2|3201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7800
MKLSPLSLLSLAAVAVQAQALPNDSTTAGISRPKAGPIPYGTSITTCNQPGTLALTFDDGPGAYTPQLLDILDEL
QVKATFFIIGTGHEDAASAAVLRRMYNAGHQLASHTYSHQSLNGPSRWTDVTANEAYFRNIFGFFPTYIRPPYLE
CNQECLNFLGERGYHVISADVDTKDFEHDDPVGIEASRRLFSEGVSSNPAGNGHIVLAHDIHANTVTNLARFMVE
ESHRLGYRLVTVGECLGDSRDNWYRQAGEAPRSY
Coding >Ophio5|7800
ATGAAGCTTTCACCGCTGTCGCTCCTCTCTTTGGCCGCTGTCGCTGTACAAGCCCAGGCGCTGCCCAACGATTCC
ACCACCGCTGGCATCTCCCGGCCCAAGGCTGGCCCCATTCCTTACGGCACCTCGATCACGACCTGCAACCAGCCG
GGAACATTGGCATTGACGTTTGATGACGGCCCGGGAGCCTATACACCGCAACTCTTGGACATCCTGGACGAGCTC
CAGGTCAAGGCCACCTTTTTCATCATCGGAACCGGCCACGAAGACGCTGCTTCCGCAGCCGTTCTGCGTCGCATG
TATAATGCCGGCCATCAACTAGCGAGCCACACGTACTCGCACCAAAGCCTTAATGGCCCGAGCCGCTGGACCGAC
GTTACGGCGAACGAAGCTTACTTCCGAAATATCTTCGGCTTCTTCCCGACTTATATCCGCCCGCCCTATCTAGAG
TGCAACCAGGAATGTCTCAACTTTCTCGGCGAGCGCGGATACCACGTCATCTCAGCCGATGTCGACACCAAAGAC
TTTGAGCACGATGACCCTGTCGGGATAGAGGCTTCTCGAAGACTCTTCAGCGAAGGTGTATCTTCCAACCCAGCG
GGCAATGGTCACATTGTGCTCGCCCACGACATTCACGCCAACACCGTTACCAACCTTGCCCGCTTCATGGTTGAA
GAGTCGCATCGTTTGGGGTACCGGCTCGTTACCGTGGGAGAATGTCTTGGGGATTCTCGGGACAATTGGTATCGG
CAAGCGGGTGAGGCGCCTCGGTCGTAC
Transcript >Ophio5|7800
ATGAAGCTTTCACCGCTGTCGCTCCTCTCTTTGGCCGCTGTCGCTGTACAAGCCCAGGCGCTGCCCAACGATTCC
ACCACCGCTGGCATCTCCCGGCCCAAGGCTGGCCCCATTCCTTACGGCACCTCGATCACGACCTGCAACCAGCCG
GGAACATTGGCATTGACGTTTGATGACGGCCCGGGAGCCTATACACCGCAACTCTTGGACATCCTGGACGAGCTC
CAGGTCAAGGCCACCTTTTTCATCATCGGAACCGGCCACGAAGACGCTGCTTCCGCAGCCGTTCTGCGTCGCATG
TATAATGCCGGCCATCAACTAGCGAGCCACACGTACTCGCACCAAAGCCTTAATGGCCCGAGCCGCTGGACCGAC
GTTACGGCGAACGAAGCTTACTTCCGAAATATCTTCGGCTTCTTCCCGACTTATATCCGCCCGCCCTATCTAGAG
TGCAACCAGGAATGTCTCAACTTTCTCGGCGAGCGCGGATACCACGTCATCTCAGCCGATGTCGACACCAAAGAC
TTTGAGCACGATGACCCTGTCGGGATAGAGGCTTCTCGAAGACTCTTCAGCGAAGGTGTATCTTCCAACCCAGCG
GGCAATGGTCACATTGTGCTCGCCCACGACATTCACGCCAACACCGTTACCAACCTTGCCCGCTTCATGGTTGAA
GAGTCGCATCGTTTGGGGTACCGGCTCGTTACCGTGGGAGAATGTCTTGGGGATTCTCGGGACAATTGGTATCGG
CAAGCGGGTGAGGCGCCTCGGTCGTACTAA
Gene >Ophio5|7800
ATGAAGCTTTCACCGCTGTCGCTCCTCTCTTTGGCCGCTGTCGCTGTACAAGCCCAGGCGCTGCCCAACGATTCG
TAAGTGGCCCCCCCCCCTCCCCCCCTGGTGTAGCAGGAGAGCGTGTGTGTGTGTGTGTGGTGAAAAGGGGGAGAG
ACAGGCAGAGATTTGAAACGACAAGCAAAGAGAGAAGAAGAGTAAGAGTACCACCTGGCTGACGTCCAATCATCA
TTGATTAGCACCACCGCTGGCATCTCCCGGCCCAAGGCTGGCCCCATTCCTTACGGCACCTCGATCACGACCTGC
AACCAGCCGGGAACATTGGCATTGACGTTTGATGACGGCCCGGGAGCCTATACACCGCAACTCTTGGACATCCTG
GACGAGCTCCAGGTCAAGGCCACCTTTTTCATCATCGGAACCGGCCACGAAGACGCTGCTTCCGCAGCCGTTCTG
CGTCGCATGTATAATGCCGGCCATCAACTAGCGAGCCACACGTACTCGCACCAAAGCCTTAATGGCCCGAGCCGC
TGGACCGACGTTACGGCGAACGAAGCTTACTTCCGAAATATCTTCGGCTTCTTCCCGACTTATATCCGCCCGCCC
TATCTAGAGTGCAACCAGGAATGTCTCAACTTTCTCGGCGAGCGCGGATACCACGTCATCTCAGCCGATGTCGAC
ACCAAAGACTTTGAGCACGATGACCCTGTCGGGATAGAGGCTTCTCGAAGACTCTTCAGCGAAGGTGTATCTTCC
AACCCAGCGGGCAATGGTCACATTGTGCTCGCCCACGACATTCACGCCAACACCGTTACCAACCTTGCCCGCTTC
ATGGTTGAAGAGTCGCATCGTTTGGGGTACCGGCTCGTTACCGTGGGAGAATGTCTTGGGGATTCTCGGGACAAT
TGGTATCGGCAAGCGGGTGAGGCGCCTCGGTCGTACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail