Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|78
Gene name
Locationscaffold_10:28136..29035
Strand-
Gene length (bp)899
Transcript length (bp)591
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04777 Evr1_Alr Erv1 / Alr family 2.8E-29 71 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 6 158 1.0E-40
sp|P27882|ERV1_YEAST Mitochondrial FAD-linked sulfhydryl oxidase ERV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV1 PE=1 SV=2 11 156 3.0E-38
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 27 158 3.0E-38
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 10 158 3.0E-38
sp|O14144|ERV1_SCHPO Mitochondrial FAD-linked sulfhydryl oxidase erv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv1 PE=3 SV=1 23 155 4.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 6 158 1.0E-40
sp|P27882|ERV1_YEAST Mitochondrial FAD-linked sulfhydryl oxidase ERV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV1 PE=1 SV=2 11 156 3.0E-38
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 27 158 3.0E-38
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 10 158 3.0E-38
sp|O14144|ERV1_SCHPO Mitochondrial FAD-linked sulfhydryl oxidase erv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv1 PE=3 SV=1 23 155 4.0E-34
sp|Q8GXX0|ERV1_ARATH FAD-linked sulfhydryl oxidase ERV1 OS=Arabidopsis thaliana GN=ERV1 PE=1 SV=1 52 175 2.0E-23
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 69 158 2.0E-13
sp|Q9Y806|ERV2_SCHPO FAD-linked sulfhydryl oxidase erv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv2 PE=3 SV=1 74 155 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016972 thiol oxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|78
MANDERKKDDDAPTANQPKKLPTGVVLDKDGKPCRNCTSFAAWAAQTKQQTRSVPAGPRPDCPPDVEALGRSTWT
LLHSVAASYPEKPSLAQQSDLLGFVRLFSRLYPCWVCAEDFQAYLGRHAPPVASRADFGFWLCGAHNDVNRKLGK
PEFDCSKLCPGLLRIGQTAARVRSCCSGLAAPAPSKPRPSDARIRS
Coding >Ophio5|78
ATGGCCAATGACGAGAGGAAGAAAGACGACGACGCTCCGACGGCCAACCAGCCCAAGAAACTGCCGACTGGCGTC
GTCCTCGACAAAGACGGAAAGCCCTGCCGCAACTGCACCTCCTTCGCCGCCTGGGCCGCCCAGACCAAGCAACAG
ACACGATCCGTCCCGGCCGGCCCTCGCCCAGATTGCCCGCCCGACGTCGAGGCCCTCGGCCGTAGCACCTGGACC
CTCCTCCATTCCGTGGCCGCCAGCTACCCGGAGAAGCCTTCGCTCGCGCAGCAGTCGGACCTCCTCGGCTTCGTC
CGTCTCTTCTCCCGCCTCTATCCCTGCTGGGTCTGCGCCGAGGACTTTCAGGCCTATCTCGGCCGCCACGCGCCG
CCCGTCGCCAGCCGCGCTGACTTCGGCTTCTGGCTCTGCGGCGCCCACAACGACGTCAATCGCAAGCTGGGCAAG
CCCGAGTTCGATTGCTCCAAGTTGTGTCCAGGGCTGTTGAGGATAGGGCAGACGGCAGCCCGTGTCCGATCGTGC
TGTTCCGGCCTCGCAGCTCCCGCTCCATCCAAACCCAGACCGAGCGACGCTCGAATCCGTTCA
Transcript >Ophio5|78
ATGGCCAATGACGAGAGGAAGAAAGACGACGACGCTCCGACGGCCAACCAGCCCAAGAAACTGCCGACTGGCGTC
GTCCTCGACAAAGACGGAAAGCCCTGCCGCAACTGCACCTCCTTCGCCGCCTGGGCCGCCCAGACCAAGCAACAG
ACACGATCCGTCCCGGCCGGCCCTCGCCCAGATTGCCCGCCCGACGTCGAGGCCCTCGGCCGTAGCACCTGGACC
CTCCTCCATTCCGTGGCCGCCAGCTACCCGGAGAAGCCTTCGCTCGCGCAGCAGTCGGACCTCCTCGGCTTCGTC
CGTCTCTTCTCCCGCCTCTATCCCTGCTGGGTCTGCGCCGAGGACTTTCAGGCCTATCTCGGCCGCCACGCGCCG
CCCGTCGCCAGCCGCGCTGACTTCGGCTTCTGGCTCTGCGGCGCCCACAACGACGTCAATCGCAAGCTGGGCAAG
CCCGAGTTCGATTGCTCCAAGTTGTGTCCAGGGCTGTTGAGGATAGGGCAGACGGCAGCCCGTGTCCGATCGTGC
TGTTCCGGCCTCGCAGCTCCCGCTCCATCCAAACCCAGACCGAGCGACGCTCGAATCCGTTCATAG
Gene >Ophio5|78
ATGGCCAATGACGAGAGGAAGAAAGACGACGACGCTCCGACGGCCAACCAGCCCAAGAAACTGCCGACTGGCGTC
GTCCTCGACAAAGACGGAAAGCCGTGAGTCGTCCGGATGCTCATGGTCTTTCGTTTTTTTTGTTTCCTCTCTAGC
TTCATGCACGAGAAAGGTGCCAATTGCCCCTGACCACTCCAGCTGCCGCAACTGCACCTCCTTCGCCGCCTGGGC
CGCCCAGACCAAGCAACAGACACGATCCGTCCCGGCCGGCCCTCGCCCAGATTGCCCGCCCGACGTCGAGGCCCT
CGGCCGTAGCACCTGGACCCTCCTCCATTCCGTGGCCGCCAGCTACCCGGAGAAGCCTTCGCTCGCGCAGCAGTC
GGACCTCCTCGGCTTCGTCCGTCTCTTCTCCCGCCTCTATCCCTGCTGGGTCTGCGCCGAGGACTTTCAGGCCTA
TCTCGGCCGCCACGCGCCGCCCGTCGCCAGCCGCGCTGACTTCGGCTTCTGGCTCTGCGGCGCCCACAACGACGT
CAATCGCAAGCTGGGCAAGCCCGAGTTCGATTGCTCCAAGTGGGAGGAGCGGTGGCGCACCGGATGGGCGGATGG
GCGCTGCGGCTGACGTGCGACACTTCCTACCTACCTACCTGCCTACCTACCTACCTAACTGCCTAGTAACCTTGG
CACCCAACTCTTCACTCAGCCACCTGTCCAATATAAGCGTCTCCAGGTTGTGTCCAGGGCTGTTGAGGATAGGGC
AGACGGCAGCCCGTGTCCGATCGTGCTGTTCCGGCCTCGCAGCTCCCGCTCCATCCAAACCCAGACCGAGCGACG
GTGCGTCATCACCAATGGTTGGGTTGCCGTACGTAGGCTGACGCGACGCGGGCCTAGCTCGAATCCGTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail