Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7798
Gene name
Locationscaffold_8:10770..11720
Strand-
Gene length (bp)950
Transcript length (bp)891
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10261 Scs3p Inositol phospholipid synthesis and fat-storage-inducing TM 1.9E-69 68 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM4|SCS3_SCHPO FIT family protein scs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scs3 PE=3 SV=1 68 292 4.0E-36
sp|Q9VRJ2|FITM_DROME FIT family protein CG10671 OS=Drosophila melanogaster GN=CG10671 PE=1 SV=1 69 287 2.0E-15
sp|B2LYG4|FITM2_PIG Fat storage-inducing transmembrane protein 2 OS=Sus scrofa GN=FITM2 PE=2 SV=1 69 287 7.0E-12
sp|Q52KL1|FITM2_DANRE Fat storage-inducing transmembrane protein 2 OS=Danio rerio GN=fitm2 PE=2 SV=1 62 287 2.0E-11
sp|A0JP80|FITM2_XENTR Fat storage-inducing transmembrane protein 2 OS=Xenopus tropicalis GN=fitm2 PE=2 SV=1 69 278 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM4|SCS3_SCHPO FIT family protein scs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scs3 PE=3 SV=1 68 292 4.0E-36
sp|Q9VRJ2|FITM_DROME FIT family protein CG10671 OS=Drosophila melanogaster GN=CG10671 PE=1 SV=1 69 287 2.0E-15
sp|B2LYG4|FITM2_PIG Fat storage-inducing transmembrane protein 2 OS=Sus scrofa GN=FITM2 PE=2 SV=1 69 287 7.0E-12
sp|Q52KL1|FITM2_DANRE Fat storage-inducing transmembrane protein 2 OS=Danio rerio GN=fitm2 PE=2 SV=1 62 287 2.0E-11
sp|A0JP80|FITM2_XENTR Fat storage-inducing transmembrane protein 2 OS=Xenopus tropicalis GN=fitm2 PE=2 SV=1 69 278 3.0E-11
sp|P59266|FITM2_MOUSE Fat storage-inducing transmembrane protein 2 OS=Mus musculus GN=Fitm2 PE=1 SV=1 69 287 4.0E-11
sp|Q8N6M3|FITM2_HUMAN Fat storage-inducing transmembrane protein 2 OS=Homo sapiens GN=FITM2 PE=2 SV=1 69 287 1.0E-09
sp|Q06676|YFT2_YEAST FIT family protein YFT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFT2 PE=1 SV=1 24 293 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0019915 lipid storage Yes
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0051235 maintenance of location No
GO:0031090 organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 27 44 17
2 77 99 22
3 238 260 22
4 264 286 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7798
MATTRGGGGTATPRLSPYLPTPLERMAVAVFPLLLVFGAVFSLLSPETRAAPYDAGTQAHAQTADEAPSYFARKA
NVFNVIFVKRGWGWTTFAFVFFLVTMRGATDRRRVQAGLRWVAATGWWMLVTQWCFGPPLIDRGFRWSGGKCEDL
GDDFLTAVACRAAGGRWRGGHDISGHVFLLVLGSLFLMQEVGWPLARTRGLGVDERCVVMNDGAVKGAGVEADGE
QTTQQGMGPAAKTAIGVVVMKLWMLLMTAIYFHTWFEKFTGLATALVGGYGLYVVPRFVPGLRAVVGLPGI
Coding >Ophio5|7798
ATGGCGACGACGCGCGGCGGCGGAGGCACGGCGACCCCGAGGCTCTCCCCGTATCTGCCGACGCCGCTCGAGAGG
ATGGCAGTGGCCGTCTTCCCGCTCCTACTCGTCTTCGGAGCCGTCTTCTCGCTCCTCTCGCCGGAAACTCGGGCA
GCACCGTACGACGCGGGCACGCAGGCTCATGCCCAGACTGCCGACGAGGCTCCCAGCTATTTTGCCCGCAAGGCC
AACGTCTTCAACGTCATCTTCGTCAAGCGCGGATGGGGATGGACCACGTTTGCCTTTGTCTTCTTCCTTGTCACG
ATGCGGGGCGCGACGGACAGACGAAGAGTGCAGGCAGGCTTGCGCTGGGTTGCGGCTACGGGCTGGTGGATGCTG
GTTACGCAGTGGTGTTTCGGGCCGCCGCTTATTGATCGTGGGTTTCGGTGGTCAGGGGGGAAGTGTGAGGATCTT
GGAGATGATTTTCTCACTGCCGTGGCCTGCAGGGCGGCGGGAGGGAGGTGGCGAGGCGGTCATGACATCTCGGGG
CATGTCTTCTTGCTTGTTCTCGGCTCGCTGTTCTTGATGCAAGAGGTCGGCTGGCCGCTTGCACGGACTCGTGGT
CTGGGAGTGGACGAGAGGTGTGTTGTCATGAACGATGGCGCGGTCAAGGGCGCGGGCGTCGAGGCGGATGGGGAG
CAGACGACGCAGCAGGGGATGGGACCAGCGGCCAAGACGGCGATTGGCGTTGTTGTGATGAAGTTGTGGATGCTG
CTGATGACGGCCATCTACTTTCATACCTGGTTTGAAAAGTTTACCGGTCTGGCGACGGCGCTGGTGGGAGGCTAT
GGACTTTATGTTGTGCCGCGATTCGTGCCCGGGCTGAGGGCTGTCGTAGGGCTGCCGGGCATA
Transcript >Ophio5|7798
ATGGCGACGACGCGCGGCGGCGGAGGCACGGCGACCCCGAGGCTCTCCCCGTATCTGCCGACGCCGCTCGAGAGG
ATGGCAGTGGCCGTCTTCCCGCTCCTACTCGTCTTCGGAGCCGTCTTCTCGCTCCTCTCGCCGGAAACTCGGGCA
GCACCGTACGACGCGGGCACGCAGGCTCATGCCCAGACTGCCGACGAGGCTCCCAGCTATTTTGCCCGCAAGGCC
AACGTCTTCAACGTCATCTTCGTCAAGCGCGGATGGGGATGGACCACGTTTGCCTTTGTCTTCTTCCTTGTCACG
ATGCGGGGCGCGACGGACAGACGAAGAGTGCAGGCAGGCTTGCGCTGGGTTGCGGCTACGGGCTGGTGGATGCTG
GTTACGCAGTGGTGTTTCGGGCCGCCGCTTATTGATCGTGGGTTTCGGTGGTCAGGGGGGAAGTGTGAGGATCTT
GGAGATGATTTTCTCACTGCCGTGGCCTGCAGGGCGGCGGGAGGGAGGTGGCGAGGCGGTCATGACATCTCGGGG
CATGTCTTCTTGCTTGTTCTCGGCTCGCTGTTCTTGATGCAAGAGGTCGGCTGGCCGCTTGCACGGACTCGTGGT
CTGGGAGTGGACGAGAGGTGTGTTGTCATGAACGATGGCGCGGTCAAGGGCGCGGGCGTCGAGGCGGATGGGGAG
CAGACGACGCAGCAGGGGATGGGACCAGCGGCCAAGACGGCGATTGGCGTTGTTGTGATGAAGTTGTGGATGCTG
CTGATGACGGCCATCTACTTTCATACCTGGTTTGAAAAGTTTACCGGTCTGGCGACGGCGCTGGTGGGAGGCTAT
GGACTTTATGTTGTGCCGCGATTCGTGCCCGGGCTGAGGGCTGTCGTAGGGCTGCCGGGCATATAG
Gene >Ophio5|7798
ATGGCGACGACGCGCGGCGGCGGAGGCACGGCGACCCCGAGGCTCTCCCCGTATCTGCCGACGCCGCTCGAGAGG
ATGGCAGTGGCCGTCTTCCCGCTCCTACTCGTCTTCGGAGCCGTCTTCTCGCTCCTCTCGCCGGAAACTCGGGCA
GCACCGTACGACGCGGGCACGCAGGCTCATGCCCAGACTGCCGACGAGGCTCCCAGCTATTTTGCCCGCAAGGCC
AACGTCTTCAACGTCATCTTCGTCAAGCGCGGATGGGGATGGACCACGTTTGCCTTTGTCTTCTTCCTTGTCACG
ATGCGGGGCGCGACGGACAGACGAAGAGTGCAGGCAGGCTTGCGCTGGGTTGCGGCTACGGGCTGGTGGATGCTG
GTTACGCAGTGGTGTTTCGGGCCGCCGCTTATTGATCGTGGGTTTCGGTGGTCAGGGGGGAAGTGTGAGGATCTT
GGAGATGATTTTCTCACTGCCGTGGCCTGCAGGGCGGCGGGAGGGAGGTGGCGAGGCGGTCATGACATCTCGGGG
CATGTCTTCTTGCTTGTTCTCGGCTCGCTGTTCTTGATGCAAGAGGTCGGCTGGCCGCTTGCACGGACTCGTGGT
CTGGGAGTGGACGAGAGGTGTGTTGTCATGAACGATGGCGCGGTCAAGGGCGCGGGCGTCGAGGCGGATGGGGAG
CAGACGACGCAGCAGGGGATGGGACCAGCGGCCAAGACGGCGATTGGCGTTGTTGTGATGAAGTTGTGGATGCTG
CTGATGACGGCCATCTACTTTCATACCTGGTTTGAAAAGGTATGTCTCTAGTTATACTCGATGGGATTTCTGCTG
TTGGCTGACTTTGCTGGGAACAGTTTACCGGTCTGGCGACGGCGCTGGTGGGAGGCTATGGACTTTATGTTGTGC
CGCGATTCGTGCCCGGGCTGAGGGCTGTCGTAGGGCTGCCGGGCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail