Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7791
Gene name
Locationscaffold_799:533..3929
Strand-
Gene length (bp)3396
Transcript length (bp)3273
Coding sequence length (bp)3270
Protein length (aa) 1090

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15469 Sec5 Exocyst complex component Sec5 3.0E-156 143 1075

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P89102|SEC5_YEAST Exocyst complex component SEC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC5 PE=1 SV=1 73 1019 8.0E-25
sp|F4HWE6|SEC5B_ARATH Exocyst complex component SEC5B OS=Arabidopsis thaliana GN=SEC5B PE=1 SV=1 142 490 1.0E-12
sp|Q96KP1|EXOC2_HUMAN Exocyst complex component 2 OS=Homo sapiens GN=EXOC2 PE=1 SV=1 711 1076 2.0E-08
sp|Q9D4H1|EXOC2_MOUSE Exocyst complex component 2 OS=Mus musculus GN=Exoc2 PE=1 SV=1 711 1076 3.0E-08
sp|O54921|EXOC2_RAT Exocyst complex component 2 OS=Rattus norvegicus GN=Exoc2 PE=1 SV=1 711 1076 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P89102|SEC5_YEAST Exocyst complex component SEC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC5 PE=1 SV=1 73 1019 8.0E-25
sp|F4HWE6|SEC5B_ARATH Exocyst complex component SEC5B OS=Arabidopsis thaliana GN=SEC5B PE=1 SV=1 142 490 1.0E-12
sp|Q96KP1|EXOC2_HUMAN Exocyst complex component 2 OS=Homo sapiens GN=EXOC2 PE=1 SV=1 711 1076 2.0E-08
sp|Q9D4H1|EXOC2_MOUSE Exocyst complex component 2 OS=Mus musculus GN=Exoc2 PE=1 SV=1 711 1076 3.0E-08
sp|O54921|EXOC2_RAT Exocyst complex component 2 OS=Rattus norvegicus GN=Exoc2 PE=1 SV=1 711 1076 6.0E-08
sp|Q9VQQ9|EXOC2_DROME Exocyst complex component 2 OS=Drosophila melanogaster GN=Sec5 PE=2 SV=1 712 1075 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7791
MPQPRLQPRVAYTSSDLTPRRLPAVCRANGVDRRPAAAEAAVCLWPTLLPVSLFVLAFLPVLASEMADYERTILD
FYQLPTPYPVKWPAENDQDDDGDEDGATANDAAGRRRSRFQALESALHDRKSLPASAQGGNLVQKDEPDPLGTSD
SVVKSLQSVGLPLQDDLRLRNRFLLSSTTFSPALLLSQVHIDADTETLIGGLDVLSQSIDQKSASLKVLVETNFE
RFVKAKATIDNVYREMKHCGEDSPQALGGRHSRHASRNNPGQGAAEGLTNPLTSPMTDSRKKNALIKESEYGLLG
IKVPLLDVSAKAEEVWGPALGGREKEAQLKTVSSFLKQFKEYAELSALVFDSIKRKDYESLVDAYNRARRFANEA
RRLSSELQGRTPDDRQLYHIVLAGRIWNDVEQQIHCFKRDVWKRLMSLQTSSRPDRMPGRRHDQHLEIIGLLLEL
GVEDNPIWIWLLTRYEQLKGRLQATADRSKVEIEVLRRRLASNDKPTAQAIAAHLRSLGRQTVEGKHPSSDAADV
IELWEKMLVFLANLLSPQGALGELVEFWQTAQGFIDGKTQRLLPLGYEDESRRHHQLPQQAVTDLAKGVVEMVEL
LRDQVLAFFASPPPEDISLLLSPQLLSPNSPVSSAALTPTTLRDPRFNIDPSNPPPPSPRRGEPWEKLAFWPPWS
NSLSGAHYLAKMLALVGSGASDMASIGPVANADGQLLDSLRSLVGLARERCVTALCGAWNNDAENIKYVEDWHRP
AESKDVTCMPAIFSAFESALLTGMQKILFVPDAMEKSGADGILLAPPTKQLQMVRSQYVTTLYKALSGMVENAER
SLAVGQDDWTTTQDSLQGSSSVASVTGKSVLDAGDRNVRMLLTLSNLQALRSQLVPSLNSQFENAFSVKLTDDSK
TIRDVLGQIDARLFQSYTKPSIEKLRATIQAGLCASDWVPAPGRRPQTAKPYVYEALLSLVLVHSQVSTTAPSLT
AQVLSFLLEQTSLQMLDAFRRRPRYSLEALMQATLDVEFVAQTLSHYTTDRASELQSQIYQELDGRTDNDARARL
QSELPEMRSVLKRLREASRNEFACFKKPKRHAQSAGGVQD
Coding >Ophio5|7791
ATGCCTCAGCCTCGTCTTCAGCCTCGCGTGGCGTACACCTCTTCTGACTTGACTCCCCGACGCCTTCCCGCCGTT
TGCCGAGCCAACGGCGTTGACCGTCGTCCAGCAGCGGCCGAAGCTGCTGTCTGTCTTTGGCCGACGCTTTTACCT
GTCTCGCTCTTTGTCTTGGCCTTTCTGCCGGTTCTCGCCTCCGAAATGGCCGACTACGAGCGCACCATCCTCGAC
TTCTACCAACTGCCTACACCCTATCCCGTCAAGTGGCCCGCTGAGAATGACCAAGACGACGACGGCGACGAAGAT
GGCGCTACCGCTAATGACGCCGCCGGTCGTCGTCGTTCCCGCTTCCAGGCTCTCGAGTCGGCTCTTCACGACCGC
AAGAGCCTTCCGGCGTCCGCACAGGGAGGGAACCTCGTCCAGAAGGATGAGCCCGATCCTCTCGGCACCTCGGAT
AGCGTCGTCAAGTCGCTGCAGAGTGTGGGCCTTCCGCTGCAGGACGATTTGCGCTTGCGAAACCGTTTTCTCCTC
AGTTCTACCACTTTTTCCCCCGCTCTCCTACTCTCACAGGTGCACATCGATGCCGACACCGAGACTCTGATCGGG
GGCCTCGACGTGCTTTCCCAGTCTATCGACCAAAAGTCTGCCTCGCTCAAAGTCTTGGTCGAGACCAACTTTGAG
AGATTTGTCAAGGCCAAGGCCACCATCGACAATGTCTACAGGGAGATGAAGCACTGCGGCGAAGATTCCCCTCAG
GCTCTGGGTGGACGTCACTCTCGCCACGCCAGTCGAAACAACCCGGGTCAGGGCGCCGCCGAAGGCCTCACCAAC
CCTCTCACCTCCCCGATGACTGATAGTCGCAAGAAAAACGCCCTCATCAAGGAGAGCGAGTATGGCTTGCTGGGA
ATCAAAGTCCCGCTGCTTGATGTGTCGGCCAAGGCCGAGGAAGTTTGGGGTCCCGCCCTGGGAGGACGCGAAAAG
GAGGCTCAACTTAAGACGGTGTCGAGTTTCCTGAAACAGTTCAAGGAGTACGCCGAGCTCAGTGCGTTGGTGTTC
GACAGCATCAAGAGGAAGGACTACGAATCGCTGGTCGATGCCTATAACCGAGCCAGAAGATTCGCCAACGAGGCG
CGCCGCTTGTCGAGCGAACTGCAGGGCCGCACGCCCGACGACAGGCAGCTATACCACATTGTGCTTGCCGGCCGT
ATCTGGAACGACGTCGAGCAGCAGATTCACTGCTTCAAGAGGGACGTTTGGAAGCGCCTCATGTCGCTCCAGACG
TCGTCGAGGCCGGATCGCATGCCTGGAAGGAGGCACGATCAACACCTGGAGATTATCGGTTTATTACTGGAGCTC
GGCGTCGAGGACAACCCCATCTGGATCTGGCTTCTAACCAGGTACGAGCAGCTCAAGGGCAGGCTGCAAGCGACG
GCCGACCGATCCAAGGTCGAGATAGAGGTGCTGCGCCGCAGGCTCGCCAGCAACGACAAGCCGACGGCCCAGGCC
ATTGCCGCTCACCTGCGCTCGCTGGGACGGCAGACTGTCGAGGGCAAGCACCCATCATCCGACGCGGCCGACGTC
ATCGAGCTGTGGGAGAAGATGCTCGTCTTCCTGGCCAACCTCCTCTCGCCGCAGGGCGCCCTCGGCGAGCTGGTC
GAATTTTGGCAGACGGCTCAGGGCTTCATCGACGGCAAGACACAACGACTGCTGCCGCTGGGCTACGAAGACGAG
TCTCGCCGTCACCACCAGCTGCCCCAGCAGGCGGTGACGGATCTGGCCAAGGGCGTGGTGGAAATGGTGGAGCTG
CTGCGAGATCAGGTGCTCGCCTTCTTCGCCAGCCCGCCGCCAGAAGATATATCTTTGCTCCTTTCTCCTCAGCTG
CTGTCACCCAACTCCCCCGTCTCTTCCGCAGCTCTGACGCCGACGACACTCCGCGACCCGCGCTTCAACATCGAT
CCCAGCAACCCCCCGCCCCCGTCCCCTAGAAGGGGCGAGCCGTGGGAGAAGCTGGCGTTTTGGCCGCCGTGGTCC
AACTCGCTCAGCGGCGCGCACTACTTGGCCAAGATGCTGGCCCTGGTGGGCTCGGGCGCGTCGGACATGGCGAGC
ATCGGCCCCGTCGCCAACGCGGACGGTCAATTGCTCGACAGCCTCAGGTCGCTGGTGGGCCTCGCCAGGGAGCGT
TGCGTCACGGCCCTGTGCGGCGCGTGGAACAACGACGCCGAGAACATCAAATATGTCGAGGACTGGCACCGACCG
GCCGAATCCAAGGACGTGACGTGCATGCCGGCCATCTTCTCGGCCTTTGAAAGCGCTCTCCTGACGGGAATGCAG
AAGATCCTCTTCGTGCCGGATGCCATGGAGAAGAGCGGCGCCGACGGCATTCTCCTCGCGCCGCCGACCAAGCAG
CTGCAGATGGTCCGCAGCCAGTACGTCACGACGCTCTACAAGGCGCTCAGCGGCATGGTGGAGAATGCAGAGCGC
TCGTTGGCCGTGGGACAAGACGACTGGACGACGACGCAGGATAGCCTGCAGGGATCCAGCTCCGTGGCCTCCGTC
ACGGGCAAGAGTGTTCTCGACGCCGGAGACAGGAATGTCCGGATGCTCCTCACACTGAGCAATCTGCAGGCCCTC
CGGTCCCAGCTCGTGCCGAGCCTCAACTCGCAGTTCGAAAACGCCTTTTCCGTCAAGCTGACGGACGACTCCAAG
ACGATCCGCGACGTCCTCGGCCAGATCGACGCCCGCCTGTTCCAGTCGTACACCAAGCCCTCGATCGAAAAGCTG
CGGGCAACGATCCAGGCCGGCCTCTGCGCGTCCGATTGGGTGCCGGCGCCGGGCCGGCGGCCACAGACGGCCAAG
CCCTACGTCTACGAGGCGCTTCTCAGCCTCGTGCTCGTGCATTCGCAGGTCTCGACCACGGCGCCGTCGCTCACG
GCCCAGGTGCTGTCCTTTCTCCTGGAGCAGACGTCGCTGCAGATGCTCGACGCCTTCCGGCGCCGGCCGCGGTAC
TCGCTCGAGGCTCTCATGCAGGCCACGCTCGACGTCGAGTTCGTGGCCCAGACGCTCAGCCACTACACCACCGAT
CGCGCGTCGGAGCTGCAGAGCCAGATCTATCAGGAGCTCGATGGCCGGACGGATAACGATGCGCGGGCCAGGCTG
CAGAGCGAGCTGCCGGAGATGCGCTCCGTGCTCAAGAGGTTGCGCGAGGCTAGCAGGAACGAGTTTGCTTGCTTC
AAGAAGCCGAAGCGTCATGCCCAGAGCGCGGGGGGGGTCCAAGAC
Transcript >Ophio5|7791
ATGCCTCAGCCTCGTCTTCAGCCTCGCGTGGCGTACACCTCTTCTGACTTGACTCCCCGACGCCTTCCCGCCGTT
TGCCGAGCCAACGGCGTTGACCGTCGTCCAGCAGCGGCCGAAGCTGCTGTCTGTCTTTGGCCGACGCTTTTACCT
GTCTCGCTCTTTGTCTTGGCCTTTCTGCCGGTTCTCGCCTCCGAAATGGCCGACTACGAGCGCACCATCCTCGAC
TTCTACCAACTGCCTACACCCTATCCCGTCAAGTGGCCCGCTGAGAATGACCAAGACGACGACGGCGACGAAGAT
GGCGCTACCGCTAATGACGCCGCCGGTCGTCGTCGTTCCCGCTTCCAGGCTCTCGAGTCGGCTCTTCACGACCGC
AAGAGCCTTCCGGCGTCCGCACAGGGAGGGAACCTCGTCCAGAAGGATGAGCCCGATCCTCTCGGCACCTCGGAT
AGCGTCGTCAAGTCGCTGCAGAGTGTGGGCCTTCCGCTGCAGGACGATTTGCGCTTGCGAAACCGTTTTCTCCTC
AGTTCTACCACTTTTTCCCCCGCTCTCCTACTCTCACAGGTGCACATCGATGCCGACACCGAGACTCTGATCGGG
GGCCTCGACGTGCTTTCCCAGTCTATCGACCAAAAGTCTGCCTCGCTCAAAGTCTTGGTCGAGACCAACTTTGAG
AGATTTGTCAAGGCCAAGGCCACCATCGACAATGTCTACAGGGAGATGAAGCACTGCGGCGAAGATTCCCCTCAG
GCTCTGGGTGGACGTCACTCTCGCCACGCCAGTCGAAACAACCCGGGTCAGGGCGCCGCCGAAGGCCTCACCAAC
CCTCTCACCTCCCCGATGACTGATAGTCGCAAGAAAAACGCCCTCATCAAGGAGAGCGAGTATGGCTTGCTGGGA
ATCAAAGTCCCGCTGCTTGATGTGTCGGCCAAGGCCGAGGAAGTTTGGGGTCCCGCCCTGGGAGGACGCGAAAAG
GAGGCTCAACTTAAGACGGTGTCGAGTTTCCTGAAACAGTTCAAGGAGTACGCCGAGCTCAGTGCGTTGGTGTTC
GACAGCATCAAGAGGAAGGACTACGAATCGCTGGTCGATGCCTATAACCGAGCCAGAAGATTCGCCAACGAGGCG
CGCCGCTTGTCGAGCGAACTGCAGGGCCGCACGCCCGACGACAGGCAGCTATACCACATTGTGCTTGCCGGCCGT
ATCTGGAACGACGTCGAGCAGCAGATTCACTGCTTCAAGAGGGACGTTTGGAAGCGCCTCATGTCGCTCCAGACG
TCGTCGAGGCCGGATCGCATGCCTGGAAGGAGGCACGATCAACACCTGGAGATTATCGGTTTATTACTGGAGCTC
GGCGTCGAGGACAACCCCATCTGGATCTGGCTTCTAACCAGGTACGAGCAGCTCAAGGGCAGGCTGCAAGCGACG
GCCGACCGATCCAAGGTCGAGATAGAGGTGCTGCGCCGCAGGCTCGCCAGCAACGACAAGCCGACGGCCCAGGCC
ATTGCCGCTCACCTGCGCTCGCTGGGACGGCAGACTGTCGAGGGCAAGCACCCATCATCCGACGCGGCCGACGTC
ATCGAGCTGTGGGAGAAGATGCTCGTCTTCCTGGCCAACCTCCTCTCGCCGCAGGGCGCCCTCGGCGAGCTGGTC
GAATTTTGGCAGACGGCTCAGGGCTTCATCGACGGCAAGACACAACGACTGCTGCCGCTGGGCTACGAAGACGAG
TCTCGCCGTCACCACCAGCTGCCCCAGCAGGCGGTGACGGATCTGGCCAAGGGCGTGGTGGAAATGGTGGAGCTG
CTGCGAGATCAGGTGCTCGCCTTCTTCGCCAGCCCGCCGCCAGAAGATATATCTTTGCTCCTTTCTCCTCAGCTG
CTGTCACCCAACTCCCCCGTCTCTTCCGCAGCTCTGACGCCGACGACACTCCGCGACCCGCGCTTCAACATCGAT
CCCAGCAACCCCCCGCCCCCGTCCCCTAGAAGGGGCGAGCCGTGGGAGAAGCTGGCGTTTTGGCCGCCGTGGTCC
AACTCGCTCAGCGGCGCGCACTACTTGGCCAAGATGCTGGCCCTGGTGGGCTCGGGCGCGTCGGACATGGCGAGC
ATCGGCCCCGTCGCCAACGCGGACGGTCAATTGCTCGACAGCCTCAGGTCGCTGGTGGGCCTCGCCAGGGAGCGT
TGCGTCACGGCCCTGTGCGGCGCGTGGAACAACGACGCCGAGAACATCAAATATGTCGAGGACTGGCACCGACCG
GCCGAATCCAAGGACGTGACGTGCATGCCGGCCATCTTCTCGGCCTTTGAAAGCGCTCTCCTGACGGGAATGCAG
AAGATCCTCTTCGTGCCGGATGCCATGGAGAAGAGCGGCGCCGACGGCATTCTCCTCGCGCCGCCGACCAAGCAG
CTGCAGATGGTCCGCAGCCAGTACGTCACGACGCTCTACAAGGCGCTCAGCGGCATGGTGGAGAATGCAGAGCGC
TCGTTGGCCGTGGGACAAGACGACTGGACGACGACGCAGGATAGCCTGCAGGGATCCAGCTCCGTGGCCTCCGTC
ACGGGCAAGAGTGTTCTCGACGCCGGAGACAGGAATGTCCGGATGCTCCTCACACTGAGCAATCTGCAGGCCCTC
CGGTCCCAGCTCGTGCCGAGCCTCAACTCGCAGTTCGAAAACGCCTTTTCCGTCAAGCTGACGGACGACTCCAAG
ACGATCCGCGACGTCCTCGGCCAGATCGACGCCCGCCTGTTCCAGTCGTACACCAAGCCCTCGATCGAAAAGCTG
CGGGCAACGATCCAGGCCGGCCTCTGCGCGTCCGATTGGGTGCCGGCGCCGGGCCGGCGGCCACAGACGGCCAAG
CCCTACGTCTACGAGGCGCTTCTCAGCCTCGTGCTCGTGCATTCGCAGGTCTCGACCACGGCGCCGTCGCTCACG
GCCCAGGTGCTGTCCTTTCTCCTGGAGCAGACGTCGCTGCAGATGCTCGACGCCTTCCGGCGCCGGCCGCGGTAC
TCGCTCGAGGCTCTCATGCAGGCCACGCTCGACGTCGAGTTCGTGGCCCAGACGCTCAGCCACTACACCACCGAT
CGCGCGTCGGAGCTGCAGAGCCAGATCTATCAGGAGCTCGATGGCCGGACGGATAACGATGCGCGGGCCAGGCTG
CAGAGCGAGCTGCCGGAGATGCGCTCCGTGCTCAAGAGGTTGCGCGAGGCTAGCAGGAACGAGTTTGCTTGCTTC
AAGAAGCCGAAGCGTCATGCCCAGAGCGCGGGGGGGGTCCAAGACTGA
Gene >Ophio5|7791
ATGCCTCAGCCTCGTCTTCAGCCTCGCGTGGCGTACACCTCTTCTGACTTGACTCCCCGACGCCTTCCCGCCGTT
TGCCGAGCCAACGGCGTTGACCGTCGTCCAGCAGCGGCCGAAGCTGCTGTCTGTCTTTGGCCGACGCTTTTACCT
GTCTCGCTCTTTGTCTTGGCCTTTCTGCCGGTTCTCGCCTCCGAAATGGCCGACTACGAGCGCACCATCCTCGAC
TTCTACCAACTGCCTACACCCTATCCCGTCAAGTGGCCCGCTGAGAATGACCAAGACGACGACGGCGACGAAGAT
GGCGCTACCGCTAATGACGCCGCCGGTCGTCGTCGTTCCCGCTTCCAGGCTCTCGAGTCGGCTCTTCACGACCGC
AAGAGCCTTCCGGCGTCCGCACAGGGAGGGAACCTCGTCCAGAAGGATGAGCCCGATCCTCTCGGCACCTCGGAT
AGCGTCGTCAAGTCGCTGCAGAGTGTGGGCCTTCCGCTGCAGGACGATTTGCGCTTGCGTAAGCCTCATGATCTC
GCTCTTGTGCCGGCTTTTATGCCCCTGTACACCAACTCACCCTTGCCTCTAGGAAACCGTTTTCTCCTCAGTTCT
ACCACTTTTTCCCCCGCTCTCCTACTCTCACAGGTGCACATCGATGCCGACACCGAGACTCTGATCGGGGGCCTC
GACGTGCTTTCCCAGTCTATCGACCAAAAGTCTGCCTCGCTCAAAGTCTTGGTCGAGACCAACTTTGAGAGATTT
GTCAAGGCCAAGGCCACCATCGACAATGTCTACAGGGAGATGAAGCACTGCGGCGAAGATTCCCCTCAGGCTCTG
GGTGGACGTCACTCTCGCCACGCCAGTCGAAACAACCCGGGTCAGGGCGCCGCCGAAGGCCTCACCAACCCTCTC
ACCTCCCCGATGACTGATAGTCGCAAGAAAAACGCCCTCATCAAGGAGAGCGAGTATGGCTTGCTGGGAATCAAA
GTCCCGCTGCTTGATGTGTCGGCCAAGGCCGAGGAAGTTTGGGGTCCCGCCCTGGGAGGACGCGAAAAGGAGGCT
CAACTTAAGACGGTGTCGAGTTTCCTGAAACAGTTCAAGGAGTACGCCGAGCTCAGTGCGTTGGTGTTCGACAGC
ATCAAGAGGAAGGACTACGAATCGCTGGTCGATGCCTATAACCGAGCCAGAAGATTCGCCAACGAGGCGCGCCGC
TTGTCGAGCGAACTGCAGGGCCGCACGCCCGACGACAGGCAGCTATACCACATTGTGCTTGCCGGCCGTATCTGG
AACGACGTCGAGCAGCAGATTCACTGCTTCAAGAGGGACGTTTGGAAGCGCCTCATGTCGCTCCAGACGTCGTCG
AGGCCGGATCGCATGCCTGGAAGGAGGCACGATCAACACCTGGAGATTATCGGTTTATTACTGGAGCTCGGCGTC
GAGGACAACCCCATCTGGATCTGGCTTCTAACCAGGTACGAGCAGCTCAAGGGCAGGCTGCAAGCGACGGCCGAC
CGATCCAAGGTCGAGATAGAGGTGCTGCGCCGCAGGCTCGCCAGCAACGACAAGCCGACGGCCCAGGCCATTGCC
GCTCACCTGCGCTCGCTGGGACGGCAGACTGTCGAGGGCAAGCACCCATCATCCGACGCGGCCGACGTCATCGAG
CTGTGGGAGAAGATGCTCGTCTTCCTGGCCAACCTCCTCTCGCCGCAGGGCGCCCTCGGCGAGCTGGTCGAATTT
TGGCAGACGGCTCAGGGCTTCATCGACGGCAAGACACAACGACTGCTGCCGCTGGGCTACGAAGACGAGTCTCGC
CGTCACCACCAGCTGCCCCAGCAGGCGGTGACGGATCTGGCCAAGGGCGTGGTGGAAATGGTGGAGCTGCTGCGA
GATCAGGTGCTCGCCTTCTTCGCCAGCCCGCCGCCAGAAGATATATCTTTGCTCCTTTCTCCTCAGCTGCTGTCA
CCCAACTCCCCCGTCTCTTCCGCAGCTCTGACGCCGACGACACTCCGCGACCCGCGCTTCAACATCGATCCCAGC
AACCCCCCGCCCCCGTCCCCTAGAAGGGGCGAGCCGTGGGAGAAGCTGGCGTTTTGGCCGCCGTGGTCCAACTCG
CTCAGCGGCGCGCACTACTTGGCCAAGATGCTGGCCCTGGTGGGCTCGGGCGCGTCGGACATGGCGAGCATCGGC
CCCGTCGCCAACGCGGACGGTCAATTGCTCGACAGCCTCAGGTCGCTGGTGGGCCTCGCCAGGGAGCGTTGCGTC
ACGGCCCTGTGCGGCGCGTGGAACAACGACGCCGAGAACATCAAATATGTCGAGGACTGGCACCGACCGGCCGAA
TCCAAGGACGTGACGTGCATGCCGGCCATCTTCTCGGCCTTTGAAAGCGCTCTCCTGACGGGAATGCAGAAGATC
CTCTTCGTGCCGGATGCCATGGAGAAGAGCGGCGCCGACGGCATTCTCCTCGCGCCGCCGACCAAGCAGCTGCAG
ATGGTCCGCAGCCAGTACGTCACGACGCTCTACAAGGCGCTCAGCGGCATGGTGGAGAATGCAGAGCGCTCGTTG
GCCGTGGGACAAGACGACTGGACGACGACGCAGGATAGCCTGCAGGGATCCAGCTCCGTGGCCTCCGTCACGGGC
AAGAGTGTTCTCGACGCCGGAGACAGGGTGAGGAGACTGGCTGCCGTGGGTGAAAATCCTGGGACTGACTCTTGG
TCACAGAATGTCCGGATGCTCCTCACACTGAGCAATCTGCAGGCCCTCCGGTCCCAGCTCGTGCCGAGCCTCAAC
TCGCAGTTCGAAAACGCCTTTTCCGTCAAGCTGACGGACGACTCCAAGACGATCCGCGACGTCCTCGGCCAGATC
GACGCCCGCCTGTTCCAGTCGTACACCAAGCCCTCGATCGAAAAGCTGCGGGCAACGATCCAGGCCGGCCTCTGC
GCGTCCGATTGGGTGCCGGCGCCGGGCCGGCGGCCACAGACGGCCAAGCCCTACGTCTACGAGGCGCTTCTCAGC
CTCGTGCTCGTGCATTCGCAGGTCTCGACCACGGCGCCGTCGCTCACGGCCCAGGTGCTGTCCTTTCTCCTGGAG
CAGACGTCGCTGCAGATGCTCGACGCCTTCCGGCGCCGGCCGCGGTACTCGCTCGAGGCTCTCATGCAGGCCACG
CTCGACGTCGAGTTCGTGGCCCAGACGCTCAGCCACTACACCACCGATCGCGCGTCGGAGCTGCAGAGCCAGATC
TATCAGGAGCTCGATGGCCGGACGGATAACGATGCGCGGGCCAGGCTGCAGAGCGAGCTGCCGGAGATGCGCTCC
GTGCTCAAGAGGTTGCGCGAGGCTAGCAGGAACGAGTTTGCTTGCTTCAAGAAGCCGAAGCGTCATGCCCAGAGC
GCGGGGGGGGTCCAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail