Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|779
Gene name
Locationscaffold_1210:1283..2618
Strand+
Gene length (bp)1335
Transcript length (bp)1272
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 2.4E-22 202 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 1 412 8.0E-31
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 77 412 8.0E-31
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 77 412 6.0E-30
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 57 394 6.0E-18
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 115 419 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 1 412 8.0E-31
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 77 412 8.0E-31
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 77 412 6.0E-30
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 57 394 6.0E-18
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 115 419 2.0E-16
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 76 394 8.0E-15
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 80 414 1.0E-14
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 85 394 6.0E-14
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 85 394 1.0E-13
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 210 408 2.0E-13
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 209 394 2.0E-13
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 76 394 3.0E-13
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 45 402 3.0E-13
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 45 402 4.0E-12
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 211 394 7.0E-12
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 242 396 7.0E-12
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 242 394 2.0E-11
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 206 402 3.0E-11
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 67 394 4.0E-11
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 219 394 3.0E-10
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 97 404 5.0E-10
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 95 342 5.0E-10
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 89 393 1.0E-09
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 242 394 4.0E-09
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 242 395 6.0E-09
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 242 396 7.0E-09
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 77 394 7.0E-09
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 160 394 8.0E-09
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 236 394 1.0E-08
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 211 362 2.0E-08
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 211 362 2.0E-08
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 230 394 4.0E-08
sp|B1P123|BX7_MAIZE TRIBOA-glucoside O-methyltransferase BX7 OS=Zea mays GN=BX7 PE=1 SV=1 192 410 6.0E-08
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 260 396 6.0E-08
sp|A8QW51|OMT2_SORBI Probable O-methyltransferase 2 OS=Sorghum bicolor GN=OMT2 PE=2 SV=1 64 394 7.0E-08
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 202 396 7.0E-08
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 214 394 1.0E-07
sp|B4XY98|AZIB2_STREG 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase OS=Streptomyces sahachiroi GN=aziB2 PE=1 SV=1 219 355 2.0E-07
sp|P39896|TCMO_STRGA Tetracenomycin polyketide synthesis 8-O-methyl transferase TcmO OS=Streptomyces glaucescens GN=tcmO PE=3 SV=1 203 355 5.0E-07
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 194 352 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|779
MSQLSSLALRLSKLANEMDAYTSDVGIAVPGIPELPAKMAQSRRELLELAEEIQVLVRDVPHYLEHQQIHYQTFT
CLRWLLRFDIFNHVPENSTPISYGQLAAAASVPAARLRSVVRMAMTSGLFTEAEAGRVAHNPLSLSLAKNESFRD
WAHFMVQYGQPSAAALAEATARWGDSEAINETAQNVAFQTDLSYFETMQQREGAADEFARYMKAIQQSSGLCLQQ
LVKGLDWSERFGERAHIVDVGGSTGNTSVSLAKAYPAFTFTVQDLPETTDLGPKALASQPDDIRDRISFMGHDFF
TAQPDMDMTPDVYLLRLIIHDWPREKARIILSHLAAGLKTKAKPGGRIVIMETVLPPPAVIPLLREARLRSRDLT
MMENFNSGERELDEWKQLLASTHPKLQILHRTQPPESLLDLMVVGLSE
Coding >Ophio5|779
ATGAGCCAGCTTTCCTCCTTGGCACTGCGTTTGAGCAAACTCGCGAATGAGATGGACGCTTATACATCTGATGTC
GGCATAGCAGTCCCCGGAATTCCCGAGTTGCCGGCGAAGATGGCGCAATCACGAAGGGAACTCTTGGAGTTGGCG
GAAGAGATTCAGGTGCTTGTCAGAGACGTTCCGCACTATCTGGAGCATCAACAGATTCATTATCAAACCTTTACA
TGCTTACGATGGCTCCTCCGATTTGACATCTTCAACCACGTTCCCGAGAACTCGACTCCCATCAGCTACGGACAA
CTTGCCGCCGCCGCTTCTGTTCCGGCCGCGCGACTCCGGTCCGTTGTGCGCATGGCCATGACGTCGGGTCTGTTC
ACCGAAGCCGAGGCTGGACGGGTGGCTCACAACCCGCTGTCTCTGTCCTTGGCCAAGAACGAGTCGTTCCGGGAC
TGGGCCCATTTCATGGTCCAATACGGCCAGCCATCGGCAGCTGCACTGGCCGAAGCCACGGCTCGATGGGGGGAC
AGCGAGGCCATCAACGAGACGGCTCAGAACGTGGCCTTCCAGACCGACTTGTCTTACTTTGAGACGATGCAGCAG
CGAGAGGGTGCGGCTGACGAGTTCGCTCGATATATGAAGGCCATACAGCAGAGCAGTGGCCTTTGTCTTCAACAG
CTGGTCAAAGGACTCGACTGGTCGGAACGGTTTGGAGAGCGAGCCCATATCGTCGATGTCGGAGGCTCTACCGGA
AACACGAGCGTCTCGCTGGCAAAGGCCTACCCGGCCTTTACTTTTACCGTTCAAGATCTTCCGGAGACGACCGAC
CTGGGACCCAAAGCACTCGCCTCTCAACCGGACGACATCCGGGACCGGATATCCTTTATGGGACATGATTTCTTC
ACAGCCCAACCGGACATGGACATGACGCCTGATGTCTACCTCCTCCGGCTGATCATCCATGACTGGCCTCGAGAA
AAGGCTCGAATCATCCTCTCCCACCTGGCCGCCGGGCTGAAGACCAAGGCAAAGCCTGGAGGGCGCATCGTCATC
ATGGAAACCGTTCTTCCACCGCCCGCTGTCATTCCCCTGCTGCGGGAGGCCAGGTTGCGGTCCCGCGATCTGACC
ATGATGGAGAATTTCAACAGCGGAGAGCGAGAGCTGGATGAATGGAAGCAGCTGTTGGCGAGCACCCATCCTAAG
CTTCAGATCCTCCATCGGACACAGCCTCCTGAGAGTCTGTTGGACTTGATGGTGGTGGGCTTAAGCGAG
Transcript >Ophio5|779
ATGAGCCAGCTTTCCTCCTTGGCACTGCGTTTGAGCAAACTCGCGAATGAGATGGACGCTTATACATCTGATGTC
GGCATAGCAGTCCCCGGAATTCCCGAGTTGCCGGCGAAGATGGCGCAATCACGAAGGGAACTCTTGGAGTTGGCG
GAAGAGATTCAGGTGCTTGTCAGAGACGTTCCGCACTATCTGGAGCATCAACAGATTCATTATCAAACCTTTACA
TGCTTACGATGGCTCCTCCGATTTGACATCTTCAACCACGTTCCCGAGAACTCGACTCCCATCAGCTACGGACAA
CTTGCCGCCGCCGCTTCTGTTCCGGCCGCGCGACTCCGGTCCGTTGTGCGCATGGCCATGACGTCGGGTCTGTTC
ACCGAAGCCGAGGCTGGACGGGTGGCTCACAACCCGCTGTCTCTGTCCTTGGCCAAGAACGAGTCGTTCCGGGAC
TGGGCCCATTTCATGGTCCAATACGGCCAGCCATCGGCAGCTGCACTGGCCGAAGCCACGGCTCGATGGGGGGAC
AGCGAGGCCATCAACGAGACGGCTCAGAACGTGGCCTTCCAGACCGACTTGTCTTACTTTGAGACGATGCAGCAG
CGAGAGGGTGCGGCTGACGAGTTCGCTCGATATATGAAGGCCATACAGCAGAGCAGTGGCCTTTGTCTTCAACAG
CTGGTCAAAGGACTCGACTGGTCGGAACGGTTTGGAGAGCGAGCCCATATCGTCGATGTCGGAGGCTCTACCGGA
AACACGAGCGTCTCGCTGGCAAAGGCCTACCCGGCCTTTACTTTTACCGTTCAAGATCTTCCGGAGACGACCGAC
CTGGGACCCAAAGCACTCGCCTCTCAACCGGACGACATCCGGGACCGGATATCCTTTATGGGACATGATTTCTTC
ACAGCCCAACCGGACATGGACATGACGCCTGATGTCTACCTCCTCCGGCTGATCATCCATGACTGGCCTCGAGAA
AAGGCTCGAATCATCCTCTCCCACCTGGCCGCCGGGCTGAAGACCAAGGCAAAGCCTGGAGGGCGCATCGTCATC
ATGGAAACCGTTCTTCCACCGCCCGCTGTCATTCCCCTGCTGCGGGAGGCCAGGTTGCGGTCCCGCGATCTGACC
ATGATGGAGAATTTCAACAGCGGAGAGCGAGAGCTGGATGAATGGAAGCAGCTGTTGGCGAGCACCCATCCTAAG
CTTCAGATCCTCCATCGGACACAGCCTCCTGAGAGTCTGTTGGACTTGATGGTGGTGGGCTTAAGCGAGTAG
Gene >Ophio5|779
ATGAGCCAGCTTTCCTCCTTGGCACTGCGTTTGAGCAAACTCGCGAATGAGATGGACGCTTATACATCTGATGTC
GGCATAGCAGTCCCCGGAATTCCCGAGTTGCCGGCGAAGATGGCGCAATCACGAAGGGAACTCTTGGAGTTGGCG
GAAGAGATTCAGGTGCTTGTCAGAGACGTTCCGCACTATCTGGAGCATCAACAGATTCATGTAAGTGTTTTCGAA
AGAAAGAAAGAAGGAAAGAAAGAATTAGAAGTGACTCGAGGACGACAGTATCAAACCTTTACATGCTTACGATGG
CTCCTCCGATTTGACATCTTCAACCACGTTCCCGAGAACTCGACTCCCATCAGCTACGGACAACTTGCCGCCGCC
GCTTCTGTTCCGGCCGCGCGACTCCGGTCCGTTGTGCGCATGGCCATGACGTCGGGTCTGTTCACCGAAGCCGAG
GCTGGACGGGTGGCTCACAACCCGCTGTCTCTGTCCTTGGCCAAGAACGAGTCGTTCCGGGACTGGGCCCATTTC
ATGGTCCAATACGGCCAGCCATCGGCAGCTGCACTGGCCGAAGCCACGGCTCGATGGGGGGACAGCGAGGCCATC
AACGAGACGGCTCAGAACGTGGCCTTCCAGACCGACTTGTCTTACTTTGAGACGATGCAGCAGCGAGAGGGTGCG
GCTGACGAGTTCGCTCGATATATGAAGGCCATACAGCAGAGCAGTGGCCTTTGTCTTCAACAGCTGGTCAAAGGA
CTCGACTGGTCGGAACGGTTTGGAGAGCGAGCCCATATCGTCGATGTCGGAGGCTCTACCGGAAACACGAGCGTC
TCGCTGGCAAAGGCCTACCCGGCCTTTACTTTTACCGTTCAAGATCTTCCGGAGACGACCGACCTGGGACCCAAA
GCACTCGCCTCTCAACCGGACGACATCCGGGACCGGATATCCTTTATGGGACATGATTTCTTCACAGCCCAACCG
GACATGGACATGACGCCTGATGTCTACCTCCTCCGGCTGATCATCCATGACTGGCCTCGAGAAAAGGCTCGAATC
ATCCTCTCCCACCTGGCCGCCGGGCTGAAGACCAAGGCAAAGCCTGGAGGGCGCATCGTCATCATGGAAACCGTT
CTTCCACCGCCCGCTGTCATTCCCCTGCTGCGGGAGGCCAGGTTGCGGTCCCGCGATCTGACCATGATGGAGAAT
TTCAACAGCGGAGAGCGAGAGCTGGATGAATGGAAGCAGCTGTTGGCGAGCACCCATCCTAAGCTTCAGATCCTC
CATCGGACACAGCCTCCTGAGAGTCTGTTGGACTTGATGGTGGTGGGCTTAAGCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail