Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7785
Gene name
Locationscaffold_795:4373..6292
Strand-
Gene length (bp)1919
Transcript length (bp)1851
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.6E-25 102 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 6 543 3.0E-47
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 8 544 8.0E-43
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 87 555 2.0E-40
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 22 541 4.0E-40
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 110 538 6.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 6 543 3.0E-47
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 8 544 8.0E-43
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 87 555 2.0E-40
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 22 541 4.0E-40
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 110 538 6.0E-40
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 92 544 7.0E-40
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 74 538 2.0E-38
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 91 542 2.0E-38
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 91 542 2.0E-38
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 66 543 1.0E-37
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 93 543 7.0E-37
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 91 541 2.0E-36
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 3 544 4.0E-35
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 3 560 9.0E-35
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 47 538 2.0E-34
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 38 537 4.0E-34
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 9 541 6.0E-34
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 26 541 1.0E-33
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 24 516 1.0E-32
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 105 541 6.0E-32
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 19 542 1.0E-31
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 87 537 3.0E-31
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 109 540 2.0E-28
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 109 540 6.0E-28
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 93 538 8.0E-27
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 109 544 1.0E-26
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 110 540 2.0E-23
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 93 538 2.0E-21
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 5 430 2.0E-13
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 94 293 1.0E-12
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 70 430 1.0E-11
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 123 274 2.0E-09
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 21 498 3.0E-08
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 113 377 5.0E-08
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 119 241 4.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 306 499 6.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 108 253 8.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 112 273 8.0E-07
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 93 255 4.0E-06
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 119 245 5.0E-06
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 113 274 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22
2 184 206 22
3 219 241 22
4 251 270 19
5 327 349 22
6 364 386 22
7 407 429 22
8 434 456 22
9 508 530 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7785
MPDMMRSTHFSDDPPQVINEKDLELANEKLKASGSAKTSHSSGNGVTEMGPTDTGKEGQAHGTELERLGTYDKYE
ITEDDCYEELGYGFSTWKKWYILTVIFWVQVSMNFNTSLYSNAIPGISQEFHVSEQAARCGAMIFLVLYAFGCEL
WAPWSEEFGRWPVLQASLFFVNIFQLPVALAPNFASVMVGRALGGLSSAGGSVTLGMIADMWEADVQQYAVAYVV
FSSVFGSVLGPIVGGFLETYLNWRWCIWVQLILGVFVQLVHALTVPETRTTIMMNRIAKKRRKEGNPNIWGPDEL
VPFRHRFSAHEVIITWIRPFKMFLTEPIVLVLSLLSGFSDALIFMFIQSFGLVYKQWGFSTIDIGLAFIPIGIGY
ALAWAAFIPAIRRNIKEREAKPNDERAQYESRLWFLLYTAPCLPIGLIGFAWTIQGPPIHWVGSMIFAAIVGVAN
YAIYMATIDYMICAYGPYSASATGGNGWARDFLAGVLTVPALPFFENIGRSSGKNLEYASTILFAISFVLVLAVY
AIYFYGPQLRARSPFAQRLADARQEHVAEGHRGSVSYDPHRRGSAASAGSMTRRFSQQHRFFGESRVTPRGTPRG
TPAASRRPSMVNIAKK
Coding >Ophio5|7785
ATGCCTGATATGATGAGGTCTACACACTTTTCCGATGACCCGCCGCAGGTCATCAACGAGAAAGATCTCGAGCTC
GCCAACGAGAAGCTCAAGGCTTCCGGCTCGGCCAAGACCAGTCACAGCAGCGGCAATGGTGTCACCGAGATGGGC
CCAACCGACACCGGAAAGGAGGGCCAGGCTCATGGCACCGAGTTGGAGAGGCTCGGCACGTACGACAAGTACGAA
ATCACCGAGGACGACTGCTACGAAGAATTGGGATACGGCTTCTCTACCTGGAAGAAGTGGTACATCCTGACCGTC
ATCTTCTGGGTTCAGGTGTCGATGAACTTCAACACGTCGCTCTACTCCAACGCCATCCCCGGCATCTCGCAAGAG
TTCCACGTCAGCGAGCAGGCCGCCCGCTGCGGTGCCATGATCTTCCTCGTCCTATACGCCTTTGGCTGCGAGCTC
TGGGCTCCCTGGTCCGAGGAGTTTGGTCGCTGGCCCGTCCTACAGGCATCCCTCTTCTTCGTCAACATCTTTCAA
CTTCCCGTCGCCCTGGCGCCCAACTTTGCCTCCGTCATGGTCGGTCGTGCCCTGGGCGGTCTGTCTTCGGCCGGA
GGTTCCGTCACGCTCGGCATGATCGCCGACATGTGGGAGGCCGACGTGCAGCAGTACGCCGTCGCCTACGTCGTC
TTCTCCTCCGTCTTTGGCTCCGTTCTCGGCCCCATCGTCGGTGGCTTCCTCGAGACGTACCTCAACTGGCGCTGG
TGCATCTGGGTACAGCTCATCCTCGGCGTCTTCGTCCAGCTCGTCCACGCCCTGACGGTGCCCGAGACGCGCACC
ACCATCATGATGAACCGCATTGCCAAGAAGCGGAGAAAGGAGGGCAACCCCAACATCTGGGGTCCCGATGAGCTG
GTGCCCTTCCGCCACCGCTTCTCGGCCCACGAGGTCATCATCACCTGGATTCGGCCTTTCAAGATGTTCTTGACC
GAACCCATCGTCCTCGTCCTCTCCCTCTTGTCCGGCTTTTCCGACGCCCTCATCTTCATGTTTATCCAGTCCTTT
GGCCTCGTCTACAAGCAATGGGGATTCAGCACCATCGATATCGGTCTGGCTTTCATCCCCATCGGTATCGGCTAT
GCCCTCGCCTGGGCCGCTTTCATCCCCGCCATCCGCCGCAACATCAAGGAGCGTGAGGCCAAACCCAACGATGAG
CGTGCTCAGTACGAGTCTCGTCTGTGGTTCCTCCTCTACACTGCGCCCTGCCTGCCCATCGGCCTCATCGGCTTC
GCCTGGACCATTCAGGGGCCGCCCATCCATTGGGTCGGCTCCATGATCTTCGCCGCCATCGTCGGTGTTGCCAAC
TACGCCATCTACATGGCCACCATCGACTACATGATCTGCGCCTACGGGCCGTATTCGGCCTCGGCCACCGGTGGA
AACGGCTGGGCCCGTGACTTCTTGGCCGGTGTGCTTACTGTGCCGGCACTCCCCTTCTTCGAGAACATTGGCCGA
TCGAGCGGCAAGAATCTCGAGTACGCGTCCACGATTCTGTTCGCCATCTCCTTTGTCCTTGTCCTGGCCGTCTAT
GCCATCTACTTCTATGGCCCCCAGCTGCGCGCTCGCTCTCCCTTTGCTCAACGGCTGGCCGATGCTCGTCAAGAA
CACGTGGCCGAGGGTCACCGCGGCAGTGTCTCGTACGATCCCCATCGCCGAGGTTCCGCCGCCTCGGCCGGTTCC
ATGACTCGTCGCTTCAGCCAACAGCACCGCTTCTTCGGTGAAAGCCGAGTCACGCCCCGCGGCACTCCTCGGGGC
ACGCCTGCGGCCAGTCGACGGCCAAGCATGGTCAACATTGCTAAGAAG
Transcript >Ophio5|7785
ATGCCTGATATGATGAGGTCTACACACTTTTCCGATGACCCGCCGCAGGTCATCAACGAGAAAGATCTCGAGCTC
GCCAACGAGAAGCTCAAGGCTTCCGGCTCGGCCAAGACCAGTCACAGCAGCGGCAATGGTGTCACCGAGATGGGC
CCAACCGACACCGGAAAGGAGGGCCAGGCTCATGGCACCGAGTTGGAGAGGCTCGGCACGTACGACAAGTACGAA
ATCACCGAGGACGACTGCTACGAAGAATTGGGATACGGCTTCTCTACCTGGAAGAAGTGGTACATCCTGACCGTC
ATCTTCTGGGTTCAGGTGTCGATGAACTTCAACACGTCGCTCTACTCCAACGCCATCCCCGGCATCTCGCAAGAG
TTCCACGTCAGCGAGCAGGCCGCCCGCTGCGGTGCCATGATCTTCCTCGTCCTATACGCCTTTGGCTGCGAGCTC
TGGGCTCCCTGGTCCGAGGAGTTTGGTCGCTGGCCCGTCCTACAGGCATCCCTCTTCTTCGTCAACATCTTTCAA
CTTCCCGTCGCCCTGGCGCCCAACTTTGCCTCCGTCATGGTCGGTCGTGCCCTGGGCGGTCTGTCTTCGGCCGGA
GGTTCCGTCACGCTCGGCATGATCGCCGACATGTGGGAGGCCGACGTGCAGCAGTACGCCGTCGCCTACGTCGTC
TTCTCCTCCGTCTTTGGCTCCGTTCTCGGCCCCATCGTCGGTGGCTTCCTCGAGACGTACCTCAACTGGCGCTGG
TGCATCTGGGTACAGCTCATCCTCGGCGTCTTCGTCCAGCTCGTCCACGCCCTGACGGTGCCCGAGACGCGCACC
ACCATCATGATGAACCGCATTGCCAAGAAGCGGAGAAAGGAGGGCAACCCCAACATCTGGGGTCCCGATGAGCTG
GTGCCCTTCCGCCACCGCTTCTCGGCCCACGAGGTCATCATCACCTGGATTCGGCCTTTCAAGATGTTCTTGACC
GAACCCATCGTCCTCGTCCTCTCCCTCTTGTCCGGCTTTTCCGACGCCCTCATCTTCATGTTTATCCAGTCCTTT
GGCCTCGTCTACAAGCAATGGGGATTCAGCACCATCGATATCGGTCTGGCTTTCATCCCCATCGGTATCGGCTAT
GCCCTCGCCTGGGCCGCTTTCATCCCCGCCATCCGCCGCAACATCAAGGAGCGTGAGGCCAAACCCAACGATGAG
CGTGCTCAGTACGAGTCTCGTCTGTGGTTCCTCCTCTACACTGCGCCCTGCCTGCCCATCGGCCTCATCGGCTTC
GCCTGGACCATTCAGGGGCCGCCCATCCATTGGGTCGGCTCCATGATCTTCGCCGCCATCGTCGGTGTTGCCAAC
TACGCCATCTACATGGCCACCATCGACTACATGATCTGCGCCTACGGGCCGTATTCGGCCTCGGCCACCGGTGGA
AACGGCTGGGCCCGTGACTTCTTGGCCGGTGTGCTTACTGTGCCGGCACTCCCCTTCTTCGAGAACATTGGCCGA
TCGAGCGGCAAGAATCTCGAGTACGCGTCCACGATTCTGTTCGCCATCTCCTTTGTCCTTGTCCTGGCCGTCTAT
GCCATCTACTTCTATGGCCCCCAGCTGCGCGCTCGCTCTCCCTTTGCTCAACGGCTGGCCGATGCTCGTCAAGAA
CACGTGGCCGAGGGTCACCGCGGCAGTGTCTCGTACGATCCCCATCGCCGAGGTTCCGCCGCCTCGGCCGGTTCC
ATGACTCGTCGCTTCAGCCAACAGCACCGCTTCTTCGGTGAAAGCCGAGTCACGCCCCGCGGCACTCCTCGGGGC
ACGCCTGCGGCCAGTCGACGGCCAAGCATGGTCAACATTGCTAAGAAGTAA
Gene >Ophio5|7785
ATGCCTGATATGATGAGGTCTACACACTTTTCCGATGACCCGCCGCAGGTCATCAACGAGAAAGATCTCGAGCTC
GCCAACGAGAAGCTCAAGGCTTCCGGCTCGGCCAAGACCAGTCACAGCAGCGGCAATGGTGTCACCGAGATGGGC
CCAACCGACACCGGAAAGGAGGGCCAGGCTCATGGCACCGAGTTGGAGAGGCTCGGCACGTACGACAAGTACGAA
ATCACCGAGGACGACTGCTACGAAGAATTGGGATACGGCTTCTCTACCTGGAAGAAGTGGTACATCCTGACCGTC
ATCTTCTGGGTTCAGGTGTCGATGAACTTCAACACGTCGCTCTACTCCAACGCCATCCCCGGCATCTCGCAAGAG
TTCCACGTCAGCGAGCAGGCCGCCCGCTGCGGTGCCATGATCTTCCTCGTCCTATACGCCTTTGGCTGCGAGCTC
TGGGCTCCCTGGTCCGAGGAGTTTGGTCGCTGGCCCGTCCTACAGGCATCCCTCTTCTTCGTCAACATCTTTCAA
CTTCCCGTCGCCCTGGCGCCCAACTTTGCCTCCGTCATGGTCGGTCGTGCCCTGGGCGGTCTGTCTTCGGCCGGA
GGTTCCGTCACGCTCGGCATGATCGCCGACATGTGGGAGGCCGACGTGCAGCAGTACGCCGTCGCCTACGTCGTC
TTCTCCTCCGTCTTTGGCTCCGTTCTCGGCCCCATCGTCGGTGGCTTCCTCGAGACGTACCTCAACTGGCGCTGG
TGCATCTGGGTACAGCTCATCCTCGGCGTCTTCGTCCAGCTCGTCCACGCCCTGACGGTGCCCGAGACGCGCACC
ACCATCATGATGAACCGCATTGCCAAGAAGCGGAGAAAGGAGGGCAACCCCAACATCTGGGGTCCCGATGAGCTG
GTGCCCTTCCGCCACCGCTTCTCGGCCCACGAGGTCATCATCACCTGGATTCGGCCTTTCAAGATGTTCTTGACC
GAACCCATCGTCCTCGTCCTCTCCCTCTTGTCCGGCTTTTCCGACGCCCTCATCTTCATGTTTATCCAGTCCTTT
GGCCTCGTCTACAAGCAATGGGGATTCAGCACCATCGATATCGGTCTGGCTTTCATCCCCATCGGTATCGGCTAT
GCCCTCGCCTGGGCCGCTTTCATCCCCGCCATCCGCCGCAACATCAAGGAGCGTGAGGCCAAACCCAACGATGAG
CGTGCTCAGTACGAGTCTCGTCTGTGGTTCCTCCTCTACACTGCGCCCTGCCTGCCCATCGGCCTCATCGGCTTC
GCCTGGACCATTCAGGGGCCGCCCATCCATTGGGTCGGCTCCATGATCTTCGCCGCCATCGTCGGTGTTGCCAAC
TACGCCATCTACATGGCCACCATCGACTACATGATCTGCGCCTACGGGCCGTATTCGGCCTCGGCCACCGGTGGA
AACGGCTGGGCCCGTGACTTCTTGGCCGGTGTGCTTACTGTGCCGGCACTCCCCTTCTTCGAGAACATTGGCCGA
TCGAGCGGCAAGAATCTCGAGTACGCGTCCACGATTCTGTTCGCCATCTCCTTTGTCCTTGTCCTGGCCGTCTAT
GCCATCTACTTCTATGGCCCCCAGCTGCGCGCTCGCTCTCCCTTTGCTCAACGGCTGGCCGATGCTCGTCAAGAA
CACGTGGCCGAGGGTCACCGCGGCAGTGTCTCGTACGATCCCCATCGCCGAGGTGAGTTCTTTTTTCCCCCCCCT
TTCTCTAGCCAGCCACCTTCTCGACGCTGACGTCCTCGTCTTCAGGTTCCGCCGCCTCGGCCGGTTCCATGACTC
GTCGCTTCAGCCAACAGCACCGCTTCTTCGGTGAAAGCCGAGTCACGCCCCGCGGCACTCCTCGGGGCACGCCTG
CGGCCAGTCGACGGCCAAGCATGGTCAACATTGCTAAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail