Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7782
Gene name
Locationscaffold_794:5308..7100
Strand+
Gene length (bp)1792
Transcript length (bp)1674
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.8E-82 85 296
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.5E-25 297 378
PF13000 Acatn Acetyl-coenzyme A transporter 1 4.2E-38 381 554

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38318|YB70_YEAST Uncharacterized membrane protein YBR220C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR220C PE=1 SV=1 76 556 2.0E-136
sp|Q9USW4|YHZ9_SCHPO Uncharacterized protein C21B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.09 PE=4 SV=1 73 486 4.0E-110
sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1 95 500 3.0E-87
sp|Q6AYY8|ACATN_RAT Acetyl-coenzyme A transporter 1 OS=Rattus norvegicus GN=Slc33a1 PE=2 SV=1 95 500 4.0E-87
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus musculus GN=Slc33a1 PE=1 SV=1 95 496 9.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38318|YB70_YEAST Uncharacterized membrane protein YBR220C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR220C PE=1 SV=1 76 556 2.0E-136
sp|Q9USW4|YHZ9_SCHPO Uncharacterized protein C21B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.09 PE=4 SV=1 73 486 4.0E-110
sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1 95 500 3.0E-87
sp|Q6AYY8|ACATN_RAT Acetyl-coenzyme A transporter 1 OS=Rattus norvegicus GN=Slc33a1 PE=2 SV=1 95 500 4.0E-87
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus musculus GN=Slc33a1 PE=1 SV=1 95 496 9.0E-87
sp|Q9ZCG7|AMPG3_RICPR Putative transporter AmpG 3 OS=Rickettsia prowazekii (strain Madrid E) GN=ampG3 PE=3 SV=1 119 238 1.0E-06
sp|Q68VW8|AMPG3_RICTY Putative transporter AmpG 3 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ampG3 PE=3 SV=1 119 238 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008521 acetyl-CoA transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0015605 organophosphate ester transmembrane transporter activity No
GO:0008514 organic anion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0005346 purine ribonucleotide transmembrane transporter activity No
GO:0003674 molecular_function No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0015216 purine nucleotide transmembrane transporter activity No
GO:0015215 nucleotide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0071077 adenosine 3',5'-bisphosphate transmembrane transporter activity No
GO:0000295 adenine nucleotide transmembrane transporter activity No
GO:1901505 carbohydrate derivative transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 152 169 17
3 182 204 22
4 224 246 22
5 267 289 22
6 309 331 22
7 351 373 22
8 383 405 22
9 412 434 22
10 449 471 22
11 516 538 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7782
MSARARRPLSTEPSQSLSVEAENANGKMHNGFEMRRKGGSPKKGNVADNVMSRSAFSLDEPVPATALGHSSRGFL
ELPRQDQRNFLLLVLLYFLQGIPMGLAMGSVPFLLKNHLSYGEIGTFSLASYPYSLKLLWSPFVDAVWSRRMGRR
KTWIVPIQFLSGLGMLWLGSRVEDMMKTMGRSGGPTVWGFMMWWFFLVLMCATQDIAVDGWALTLLTPANVSYAS
TAQTVGLTAGHFLSFTVFLALNASDFANKWLRTVPSDEGLVSLGGYLTLWGWTYIAVTIGLALLKREEPSHNEDG
VWDVYRTMWGILKLGNVQAMIIVHLIAKLGFQANDGVTNLKLLDKGFGKENMALTVLIDFPFEIGLGYYAGMWSQ
RYTPMRLWCWGFVGRLAAAMVAQLTVMVFPSEGVTTWYLLMVIGEHVLSTFTNTVMFVAVSAFHAKVSDPVIGGT
YMTLLATVSNLGGTFPRYFVLRLVDALTIATCRPGPAAERAKLGDAAVTSAFSCXXXXXXXXXXXXXXXXXXXXX
XXXXXXVTFFWYIRPKVMHLQALPLRAWRLSK
Coding >Ophio5|7782
ATGAGTGCTCGAGCCAGACGGCCGCTATCGACAGAGCCCAGTCAGAGCCTGTCGGTCGAGGCGGAGAATGCCAAC
GGGAAGATGCACAACGGCTTCGAGATGCGGCGCAAAGGTGGCAGCCCCAAGAAGGGCAACGTGGCCGACAACGTC
ATGTCGCGCTCGGCCTTTTCGCTCGACGAGCCGGTGCCGGCTACGGCCTTGGGCCACAGCAGTCGCGGCTTTCTA
GAGCTGCCACGGCAGGATCAGCGCAACTTTTTGCTGCTGGTGCTGCTCTACTTTTTGCAGGGCATCCCGATGGGC
CTCGCCATGGGGTCGGTGCCGTTCCTACTCAAGAACCACTTGTCGTACGGCGAGATCGGGACGTTTAGTCTCGCG
TCGTATCCTTACTCGCTGAAGCTGCTGTGGAGTCCGTTTGTGGACGCGGTATGGAGCCGGCGGATGGGACGGCGC
AAGACGTGGATTGTGCCGATCCAGTTCCTGTCGGGCCTGGGCATGTTGTGGCTCGGGTCGCGAGTCGAGGACATG
ATGAAGACGATGGGGCGGTCTGGAGGGCCGACGGTGTGGGGGTTCATGATGTGGTGGTTCTTCCTGGTGCTGATG
TGCGCGACGCAGGACATTGCCGTTGACGGCTGGGCTTTGACGCTGCTGACGCCGGCCAACGTGTCGTACGCGTCG
ACGGCGCAGACGGTGGGCCTCACGGCAGGCCACTTTCTGTCCTTTACCGTCTTTCTGGCCCTCAACGCGAGCGAC
TTCGCCAACAAGTGGCTACGGACCGTCCCTTCGGACGAGGGCCTCGTGTCGCTGGGCGGCTACCTGACGCTCTGG
GGTTGGACCTACATTGCCGTGACGATTGGGCTGGCGCTGCTGAAGCGCGAGGAGCCTTCGCACAACGAGGACGGC
GTCTGGGACGTGTACCGCACCATGTGGGGGATCCTGAAGCTGGGCAACGTGCAGGCCATGATTATCGTCCACCTG
ATTGCCAAGCTGGGCTTCCAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAGGAA
AACATGGCGCTGACGGTGCTCATCGACTTTCCCTTTGAGATTGGCCTCGGCTACTACGCCGGCATGTGGTCTCAG
CGGTACACGCCCATGCGGCTGTGGTGCTGGGGCTTCGTCGGCAGGCTGGCGGCCGCCATGGTGGCCCAGCTGACC
GTCATGGTCTTTCCCAGCGAGGGCGTGACGACGTGGTATCTGCTCATGGTGATTGGGGAGCATGTGCTGTCGACG
TTTACGAATACCGTCATGTTTGTCGCCGTGTCTGCCTTTCACGCCAAGGTGTCGGATCCGGTGATTGGGGGCACG
TATATGACGTTGCTGGCGACCGTCTCCAACCTAGGCGGCACGTTCCCTCGCTACTTTGTGCTGCGCCTCGTCGAC
GCGCTGACGATAGCGACATGCCGACCGGGACCGGCTGCGGAGCGGGCCAAGTTGGGCGACGCGGCCGTGACGTCG
GCCTTTTCCTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNGTCACCTTCTTTTGGTATATCCGGCCCAAGGTGATGCATCTGCAGGCGTTGCCGCTG
AGGGCGTGGCGGTTGTCCAAG
Transcript >Ophio5|7782
ATGAGTGCTCGAGCCAGACGGCCGCTATCGACAGAGCCCAGTCAGAGCCTGTCGGTCGAGGCGGAGAATGCCAAC
GGGAAGATGCACAACGGCTTCGAGATGCGGCGCAAAGGTGGCAGCCCCAAGAAGGGCAACGTGGCCGACAACGTC
ATGTCGCGCTCGGCCTTTTCGCTCGACGAGCCGGTGCCGGCTACGGCCTTGGGCCACAGCAGTCGCGGCTTTCTA
GAGCTGCCACGGCAGGATCAGCGCAACTTTTTGCTGCTGGTGCTGCTCTACTTTTTGCAGGGCATCCCGATGGGC
CTCGCCATGGGGTCGGTGCCGTTCCTACTCAAGAACCACTTGTCGTACGGCGAGATCGGGACGTTTAGTCTCGCG
TCGTATCCTTACTCGCTGAAGCTGCTGTGGAGTCCGTTTGTGGACGCGGTATGGAGCCGGCGGATGGGACGGCGC
AAGACGTGGATTGTGCCGATCCAGTTCCTGTCGGGCCTGGGCATGTTGTGGCTCGGGTCGCGAGTCGAGGACATG
ATGAAGACGATGGGGCGGTCTGGAGGGCCGACGGTGTGGGGGTTCATGATGTGGTGGTTCTTCCTGGTGCTGATG
TGCGCGACGCAGGACATTGCCGTTGACGGCTGGGCTTTGACGCTGCTGACGCCGGCCAACGTGTCGTACGCGTCG
ACGGCGCAGACGGTGGGCCTCACGGCAGGCCACTTTCTGTCCTTTACCGTCTTTCTGGCCCTCAACGCGAGCGAC
TTCGCCAACAAGTGGCTACGGACCGTCCCTTCGGACGAGGGCCTCGTGTCGCTGGGCGGCTACCTGACGCTCTGG
GGTTGGACCTACATTGCCGTGACGATTGGGCTGGCGCTGCTGAAGCGCGAGGAGCCTTCGCACAACGAGGACGGC
GTCTGGGACGTGTACCGCACCATGTGGGGGATCCTGAAGCTGGGCAACGTGCAGGCCATGATTATCGTCCACCTG
ATTGCCAAGCTGGGCTTCCAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAGGAA
AACATGGCGCTGACGGTGCTCATCGACTTTCCCTTTGAGATTGGCCTCGGCTACTACGCCGGCATGTGGTCTCAG
CGGTACACGCCCATGCGGCTGTGGTGCTGGGGCTTCGTCGGCAGGCTGGCGGCCGCCATGGTGGCCCAGCTGACC
GTCATGGTCTTTCCCAGCGAGGGCGTGACGACGTGGTATCTGCTCATGGTGATTGGGGAGCATGTGCTGTCGACG
TTTACGAATACCGTCATGTTTGTCGCCGTGTCTGCCTTTCACGCCAAGGTGTCGGATCCGGTGATTGGGGGCACG
TATATGACGTTGCTGGCGACCGTCTCCAACCTAGGCGGCACGTTCCCTCGCTACTTTGTGCTGCGCCTCGTCGAC
GCGCTGACGATAGCGACATGCCGACCGGGACCGGCTGCGGAGCGGGCCAAGTTGGGCGACGCGGCCGTGACGTCG
GCCTTTTCCTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNGTCACCTTCTTTTGGTATATCCGGCCCAAGGTGATGCATCTGCAGGCGTTGCCGCTG
AGGGCGTGGCGGTTGTCCAAGTGA
Gene >Ophio5|7782
ATGAGTGCTCGAGCCAGACGGCCGCTATCGACAGAGCCCAGTCAGAGCCTGTCGGTCGAGGCGGAGAATGCCAAC
GGGAAGATGCACAACGGCTTCGAGATGCGGCGCAAAGGTGGCAGCCCCAAGAAGGGCAACGTGGCCGACAACGTC
ATGTCGCGCTCGGCCTTTTCGCTCGACGAGCCGGTGCCGGCTACGGCCTTGGGCCACAGCAGTCGCGGCTTTCTA
GAGCTGCCACGGCAGGATCAGCGCAACTTTTTGCTGCTGGTGCTGCTCTACTTTTTGCAGGGCATCCCGATGGGC
CTCGCCATGGGGTCGGTGCCGTTCCTACTCAAGAACCACTTGTCGTACGGCGAGATCGGGACGTTTAGTCTCGCG
TCGTATCCTTACTCGCTGAAGCTGCTGTGGAGTCCGTTTGTGGACGCGGTATGGAGCCGGCGGATGGGACGGCGC
AAGACGTGGATTGTGCCGATCCAGTTCCTGTCGGGCCTGGGCATGTTGTGGCTCGGGTCGCGAGTCGAGGACATG
ATGAAGACGATGGGGCGGTCTGGAGGGCCGACGGTGTGGGGGTTCATGATGTGGTGGTTCTTCCTGGTGCTGATG
TGCGCGACGCAGGACATTGCCGTTGACGGCTGGGCTTTGACGCTGCTGACGCCGGCCAACGTGTCGTACGCGTCG
ACGGCGCAGACGGTGGGCCTCACGGCAGGCCACTTTCTGTCCTTTACCGTCTTTCTGGCCCTCAACGCGAGCGAC
TTCGCCAACAAGTGGCTACGGACCGTCCCTTCGGACGAGGGCCTCGTGTCGCTGGGCGGCTACCTGACGCTCTGG
GGTTGGACCTACATTGCCGTGACGATTGGGCTGGCGCTGCTGAAGCGCGAGGAGCCTTCGCACAACGAGGACGGC
GTCTGGGACGTGTACCGCACCATGTGGGGGATCCTGAAGCTGGGCAACGTGCAGGCCATGATTATCGTCCACCTG
ATTGCCAAGCTGGGCTTCCAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAGGAA
AACATGGCGCTGACGGTGCTCATCGACTTTCCCTTTGAGATTGGCCTCGGCTACTACGCCGGCATGTGGTCTCAG
CGGTACACGCCCATGCGGCTGTGGTGCTGGGGCTTCGTCGGCAGGCTGGCGGCCGCCATGGTGGCCCAGCTGACC
GTCATGGTCTTTCCCAGCGAGGGCGTGACGACGTGGTATCTGCTCATGGTGATTGGGGAGCATGTGCTGTCGACG
TTTACGAATACCGTCATGTTTGTCGCCGTGTCTGCCTTTCACGCCAAGGTGTCGGATCCGGTGATTGGGGGCACG
TATATGACGTTGCTGGCGACGTGCGTCTTCTTTTTTTTTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNTTTT
TTTTCCCTCCCTTCCCCCGTCTTTCTCTGCTGCTTTATCTTGGCTGACGGACTTGGCGTACAGCGTCTCCAACCT
AGGCGGCACGTTCCCTCGCTACTTTGTGCTGCGCCTCGTCGACGCGCTGACGATAGCGACATGCCGACCGGGACC
GGCTGCGGAGCGGGCCAAGTTGGGCGACGCGGCCGTGACGTCGGCCTTTTCCTGCNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCACCTTCTTTTG
GTATATCCGGCCCAAGGTGATGCATCTGCAGGCGTTGCCGCTGAGGGCGTGGCGGTTGTCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail