Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7779
Gene name
Locationscaffold_794:458..1088
Strand+
Gene length (bp)630
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 6.7E-10 59 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RK96|YAE1_MAGO7 Uncharacterized protein YAE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YAE1 PE=3 SV=1 24 176 1.0E-35
sp|A7EB95|YAE1_SCLS1 Uncharacterized protein yae1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=yae1 PE=3 SV=1 36 177 7.0E-33
sp|A6RL85|YAE1_BOTFB Uncharacterized protein yae1 OS=Botryotinia fuckeliana (strain B05.10) GN=yae1 PE=3 SV=1 15 177 2.0E-32
sp|Q0V5P6|YAE1_PHANO Uncharacterized protein YAE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YAE1 PE=3 SV=1 21 177 7.0E-20
sp|A1D7X8|YAE1_NEOFI Uncharacterized protein yae1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=yae1 PE=3 SV=1 30 182 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RK96|YAE1_MAGO7 Uncharacterized protein YAE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YAE1 PE=3 SV=1 24 176 1.0E-35
sp|A7EB95|YAE1_SCLS1 Uncharacterized protein yae1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=yae1 PE=3 SV=1 36 177 7.0E-33
sp|A6RL85|YAE1_BOTFB Uncharacterized protein yae1 OS=Botryotinia fuckeliana (strain B05.10) GN=yae1 PE=3 SV=1 15 177 2.0E-32
sp|Q0V5P6|YAE1_PHANO Uncharacterized protein YAE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YAE1 PE=3 SV=1 21 177 7.0E-20
sp|A1D7X8|YAE1_NEOFI Uncharacterized protein yae1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=yae1 PE=3 SV=1 30 182 4.0E-19
sp|Q6C531|YAE1_YARLI Uncharacterized protein YAE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAE1 PE=3 SV=1 45 168 4.0E-18
sp|Q1DQS5|YAE1_COCIM Uncharacterized protein YAE1 OS=Coccidioides immitis (strain RS) GN=YAE1 PE=3 SV=1 29 167 1.0E-17
sp|Q4WWW5|YAE1_ASPFU Uncharacterized protein yae1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yae1 PE=3 SV=1 30 182 2.0E-17
sp|A2QF59|YAE1_ASPNC Uncharacterized protein yae1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=yae1 PE=3 SV=1 32 101 4.0E-17
sp|Q6FUV0|YAE1_CANGA Uncharacterized protein YAE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAE1 PE=3 SV=1 31 176 5.0E-17
sp|A6ZQ26|YAE1_YEAS7 Uncharacterized protein YAE1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YAE1 PE=3 SV=1 31 176 9.0E-17
sp|P47118|YAE1_YEAST Uncharacterized protein YAE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAE1 PE=1 SV=1 31 176 5.0E-16
sp|Q0CX45|YAE1_ASPTN Uncharacterized protein yae1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=yae1 PE=3 SV=1 32 108 6.0E-16
sp|A1CJJ9|YAE1_ASPCL Uncharacterized protein yae1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=yae1 PE=3 SV=1 32 101 3.0E-15
sp|Q6BL68|YAE1_DEBHA Uncharacterized protein YAE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YAE1 PE=3 SV=2 47 167 9.0E-12
sp|Q9P840|YAE1_CANAL Uncharacterized protein YAE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAE1 PE=3 SV=1 55 163 3.0E-11
sp|A3LWJ7|YAE1_PICST Uncharacterized protein YAE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=YAE1 PE=3 SV=2 35 171 2.0E-10
sp|A7TE16|YAE1_VANPO Uncharacterized protein YAE1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YAE1 PE=3 SV=1 34 168 4.0E-10
sp|Q6CV86|YAE1_KLULA Uncharacterized protein YAE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAE1 PE=3 SV=1 47 136 3.0E-09
sp|A5DLN4|YAE1_PICGU Uncharacterized protein YAE1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=YAE1 PE=3 SV=2 45 168 3.0E-07
sp|Q753A3|YAE1_ASHGO Uncharacterized protein YAE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YAE1 PE=3 SV=2 47 107 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7779
MAIVKRLSLLSRVLTMHMDRPAEEAASEANATSLDDVFGAEARHPSDMARLQTEHATAGYREAIAAAKQSTIQAG
FDDGFRLGAALGLRAGRILGVLQGICEAVGTETDAAAEAERLLATAREELSTSAIFSSSYWTPDGESKFHMGEGE
EDVANGHPLIKKWNSLVDQQLTQWAIDEAVLDAETGRLPSDELLLSSSAPYGARPPLDW*
Coding >Ophio5|7779
ATGGCCATCGTCAAGAGACTCTCTCTCCTCTCTCGAGTCCTCACCATGCACATGGATCGGCCGGCGGAAGAAGCT
GCCTCCGAAGCCAACGCTACCTCCCTCGATGACGTCTTCGGCGCCGAAGCCCGCCATCCGTCCGACATGGCGCGG
CTGCAGACGGAGCACGCGACGGCCGGCTATCGGGAGGCCATCGCGGCCGCCAAGCAGTCGACTATCCAGGCAGGC
TTCGACGACGGGTTTCGTCTGGGTGCTGCGTTAGGACTGCGGGCAGGTCGGATCTTGGGGGTTCTCCAAGGAATT
TGTGAAGCCGTTGGGACCGAGACCGATGCTGCGGCTGAAGCGGAGAGGCTACTGGCTACGGCTCGGGAGGAGCTC
AGCACGAGTGCCATTTTCTCTTCATCCTACTGGACGCCAGACGGCGAGAGCAAATTTCATATGGGAGAAGGCGAA
GAAGACGTGGCCAATGGCCACCCTTTGATCAAGAAGTGGAACAGTCTTGTCGATCAGCAGCTTACACAATGGGCG
ATAGATGAAGCCGTCTTGGATGCCGAGACGGGCCGGCTGCCAAGCGACGAATTGCTCCTCTCCTCATCTGCCCCT
TATGGAGCGAGGCCACCCCTGGACTGGTGA
Transcript >Ophio5|7779
ATGGCCATCGTCAAGAGACTCTCTCTCCTCTCTCGAGTCCTCACCATGCACATGGATCGGCCGGCGGAAGAAGCT
GCCTCCGAAGCCAACGCTACCTCCCTCGATGACGTCTTCGGCGCCGAAGCCCGCCATCCGTCCGACATGGCGCGG
CTGCAGACGGAGCACGCGACGGCCGGCTATCGGGAGGCCATCGCGGCCGCCAAGCAGTCGACTATCCAGGCAGGC
TTCGACGACGGGTTTCGTCTGGGTGCTGCGTTAGGACTGCGGGCAGGTCGGATCTTGGGGGTTCTCCAAGGAATT
TGTGAAGCCGTTGGGACCGAGACCGATGCTGCGGCTGAAGCGGAGAGGCTACTGGCTACGGCTCGGGAGGAGCTC
AGCACGAGTGCCATTTTCTCTTCATCCTACTGGACGCCAGACGGCGAGAGCAAATTTCATATGGGAGAAGGCGAA
GAAGACGTGGCCAATGGCCACCCTTTGATCAAGAAGTGGAACAGTCTTGTCGATCAGCAGCTTACACAATGGGCG
ATAGATGAAGCCGTCTTGGATGCCGAGACGGGCCGGCTGCCAAGCGACGAATTGCTCCTCTCCTCATCTGCCCCT
TATGGAGCGAGGCCACCCCTGGACTGGTGA
Gene >Ophio5|7779
ATGGCCATCGTCAAGAGACTCTCTCTCCTCTCTCGAGTCCTCACCATGCACATGGATCGGCCGGCGGAAGAAGCT
GCCTCCGAAGCCAACGCTACCTCCCTCGATGACGTCTTCGGCGCCGAAGCCCGCCATCCGTCCGACATGGCGCGG
CTGCAGACGGAGCACGCGACGGCCGGCTATCGGGAGGCCATCGCGGCCGCCAAGCAGTCGACTATCCAGGCAGGC
TTCGACGACGGGTTTCGTCTGGGTGCTGCGTTAGGACTGCGGGCAGGTCGGATCTTGGGGGTTCTCCAAGGAATT
TGTGAAGCCGTTGGGACCGAGACCGATGCTGCGGCTGAAGCGGAGAGGCTACTGGCTACGGCTCGGGAGGAGCTC
AGCACGAGTGCCATTTTCTCTTCATCCTACTGGACGCCAGACGGCGAGAGCAAATTTCATATGGGAGAAGGCGAA
GAAGACGTGGCCAATGGCCACCCTTTGATCAAGAAGTGGAACAGTCTTGTCGATCAGCAGCTTACACAATGGGCG
ATAGATGAAGCCGTCTTGGATGCCGAGACGGGCCGGCTGCCAAGCGACGAATTGCTCCTCTCCTCATCTGCCCCT
TATGGAGCGAGGCCACCCCTGGACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail