Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7771
Gene name
Locationscaffold_791:6450..7185
Strand-
Gene length (bp)735
Transcript length (bp)678
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3059.27 948.12 5170.41
CcL In ants, during behavior modification 3615.58 704.23 6526.93
CcD In ants, recently dead 4678.46 1202.57 8154.36

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.685863 no
SC16a CcD 0.235608 no
CcL CcD 0.524852 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7771
MRFHSLFASGVFALAVNAQGVTSSAEAPMASSAYEDSKPSQTYSPSPAEASASACLAACNGDVNCKAHCITVPSP
NKDQAKATNDCTANCAKGDGSKATNDAYSTCVQKCISDNFYNQPIGTPDNKHFAGGSGNSGNAGSSSSSDTGNDG
ASASGTATGTGATATQTDTDESSSSSSSASRSASASGSSSSGTRAAASSTSQGLAPAVTAAPAAALGLVAMVLAL
Coding >Ophio5|7771
ATGCGTTTCCACAGCCTGTTTGCCAGCGGCGTCTTCGCCCTCGCCGTCAACGCTCAGGGTGTCACCTCGTCGGCC
GAGGCGCCCATGGCTTCGTCGGCGTATGAAGACTCCAAGCCGTCGCAGACGTACTCGCCTTCGCCTGCCGAGGCG
TCCGCCAGCGCGTGTCTTGCCGCTTGCAATGGGGATGTGAACTGCAAGGCTCACTGCATCACGGTCCCCTCGCCC
AACAAGGACCAGGCCAAGGCCACCAACGACTGCACCGCCAATTGCGCCAAGGGCGACGGCTCAAAGGCCACCAAC
GACGCCTATAGCACTTGCGTCCAGAAGTGCATCTCGGACAACTTCTATAACCAGCCTATTGGCACTCCCGACAAC
AAGCACTTTGCCGGTGGCTCGGGCAACTCCGGAAACGCGGGCAGCAGCAGCAGCAGCGATACCGGCAACGACGGC
GCGAGTGCTTCTGGTACGGCTACCGGCACCGGCGCCACCGCCACTCAGACCGATACGGACGAGTCTTCTTCTTCT
TCTTCTTCCGCCTCCAGGTCTGCCTCTGCCTCTGGCTCCTCCTCCTCCGGCACCCGCGCTGCGGCCTCGTCGACG
TCGCAGGGTCTTGCCCCGGCTGTCACCGCCGCGCCCGCCGCTGCCCTTGGTCTGGTCGCCATGGTTCTTGCTCTG
Transcript >Ophio5|7771
ATGCGTTTCCACAGCCTGTTTGCCAGCGGCGTCTTCGCCCTCGCCGTCAACGCTCAGGGTGTCACCTCGTCGGCC
GAGGCGCCCATGGCTTCGTCGGCGTATGAAGACTCCAAGCCGTCGCAGACGTACTCGCCTTCGCCTGCCGAGGCG
TCCGCCAGCGCGTGTCTTGCCGCTTGCAATGGGGATGTGAACTGCAAGGCTCACTGCATCACGGTCCCCTCGCCC
AACAAGGACCAGGCCAAGGCCACCAACGACTGCACCGCCAATTGCGCCAAGGGCGACGGCTCAAAGGCCACCAAC
GACGCCTATAGCACTTGCGTCCAGAAGTGCATCTCGGACAACTTCTATAACCAGCCTATTGGCACTCCCGACAAC
AAGCACTTTGCCGGTGGCTCGGGCAACTCCGGAAACGCGGGCAGCAGCAGCAGCAGCGATACCGGCAACGACGGC
GCGAGTGCTTCTGGTACGGCTACCGGCACCGGCGCCACCGCCACTCAGACCGATACGGACGAGTCTTCTTCTTCT
TCTTCTTCCGCCTCCAGGTCTGCCTCTGCCTCTGGCTCCTCCTCCTCCGGCACCCGCGCTGCGGCCTCGTCGACG
TCGCAGGGTCTTGCCCCGGCTGTCACCGCCGCGCCCGCCGCTGCCCTTGGTCTGGTCGCCATGGTTCTTGCTCTG
TAA
Gene >Ophio5|7771
ATGCGTTTCCACAGCCTGTTTGCCAGCGGCGTCTTCGCCCTCGCCGTCAACGCTCAGGGTGTCACCTCGTCGGCC
GAGGCGCCCATGGCTTCGTCGGCGTATGAAGACTCCAAGCCGTCGCAGACGTACTCGCCTTCGCCTGCCGAGGCG
TCCGCCAGCGCGTGTCTTGCCGCTTGCAATGGGGATGTGAACTGCAAGGCTCACTGCATCACGGTATGTCTACCT
TGAACATATCGGCCTCGCGTCGCGTCTAGCTGACTTGGTGGGAAGGTCCCCTCGCCCAACAAGGACCAGGCCAAG
GCCACCAACGACTGCACCGCCAATTGCGCCAAGGGCGACGGCTCAAAGGCCACCAACGACGCCTATAGCACTTGC
GTCCAGAAGTGCATCTCGGACAACTTCTATAACCAGCCTATTGGCACTCCCGACAACAAGCACTTTGCCGGTGGC
TCGGGCAACTCCGGAAACGCGGGCAGCAGCAGCAGCAGCGATACCGGCAACGACGGCGCGAGTGCTTCTGGTACG
GCTACCGGCACCGGCGCCACCGCCACTCAGACCGATACGGACGAGTCTTCTTCTTCTTCTTCTTCCGCCTCCAGG
TCTGCCTCTGCCTCTGGCTCCTCCTCCTCCGGCACCCGCGCTGCGGCCTCGTCGACGTCGCAGGGTCTTGCCCCG
GCTGTCACCGCCGCGCCCGCCGCTGCCCTTGGTCTGGTCGCCATGGTTCTTGCTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail