Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7764
Gene name
Locationscaffold_79:31012..33307
Strand-
Gene length (bp)2295
Transcript length (bp)2175
Coding sequence length (bp)2172
Protein length (aa) 724

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08172 CASP_C CASP C terminal 1.1E-93 434 681

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59795|CASP_SCHPO Protein CASP OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coy1 PE=3 SV=1 29 679 2.0E-68
sp|P34237|CASP_YEAST Protein CASP OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COY1 PE=1 SV=2 29 681 3.0E-68
sp|Q5R8V1|CASP_PONAB Protein CASP OS=Pongo abelii GN=CUTL1 PE=2 SV=1 26 696 2.0E-53
sp|Q13948|CASP_HUMAN Protein CASP OS=Homo sapiens GN=CUX1 PE=1 SV=2 26 696 2.0E-52
sp|P70403|CASP_MOUSE Protein CASP OS=Mus musculus GN=Cux1 PE=1 SV=2 36 700 6.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59795|CASP_SCHPO Protein CASP OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coy1 PE=3 SV=1 29 679 2.0E-68
sp|P34237|CASP_YEAST Protein CASP OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COY1 PE=1 SV=2 29 681 3.0E-68
sp|Q5R8V1|CASP_PONAB Protein CASP OS=Pongo abelii GN=CUTL1 PE=2 SV=1 26 696 2.0E-53
sp|Q13948|CASP_HUMAN Protein CASP OS=Homo sapiens GN=CUX1 PE=1 SV=2 26 696 2.0E-52
sp|P70403|CASP_MOUSE Protein CASP OS=Mus musculus GN=Cux1 PE=1 SV=2 36 700 6.0E-51
sp|Q9LS42|CASP_ARATH Protein CASP OS=Arabidopsis thaliana GN=CASP PE=1 SV=2 36 688 2.0E-42
sp|P53565|CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus GN=Cux1 PE=1 SV=2 26 428 5.0E-25
sp|Q8IA98|CASP_CAEEL Protein CASP OS=Caenorhabditis elegans GN=ceh-44 PE=3 SV=1 35 676 3.0E-22
sp|P53564|CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus GN=Cux1 PE=1 SV=3 44 428 1.0E-21
sp|P39880|CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens GN=CUX1 PE=1 SV=3 44 428 5.0E-21
sp|Q9BL02|CUT_CAEEL Homeobox protein cut-like ceh-44 OS=Caenorhabditis elegans GN=ceh-44 PE=3 SV=1 35 425 2.0E-09
sp|O14529|CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens GN=CUX2 PE=1 SV=4 26 133 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0030173 integral component of Golgi membrane Yes
GO:0006891 intra-Golgi vesicle-mediated transport Yes
GO:0031301 integral component of organelle membrane No
GO:0016192 vesicle-mediated transport No
GO:0016021 integral component of membrane No
GO:0031300 intrinsic component of organelle membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0048193 Golgi vesicle transport No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0006810 transport No
GO:0031228 intrinsic component of Golgi membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 659 678 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 76.88 41.12 112.63
CcL In ants, during behavior modification 63.64 34.50 92.78
CcD In ants, recently dead 48.87 26.68 71.06

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.446155 no
SC16a CcD 0.046887 yes
CcL CcD 0.261243 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7764
MADAAQAPAPAPAPVTGLASDPVEGGNKFQRAISAWRNVDLTTLTASLDNTASEIVTYQRDSTVQRKDLAQKTKE
FRKLEDASKLAEIKGLLKAYQTFIDLLTTHTKSVNSAFLQAYTSISDAPDPYPLLEAAVDSMLVTEETLPRLTEE
NQRLQENVVKLTTQLGDAESKLQVERAARKESEDTLEARVKGVESSWTAVLDEKRDNWEARERSLEEKLENQERL
LNEMRASYEVGQRLGLSGDDADTQRGNASSAELEMLHSELERAGSRLAEVEARNEQMRLELAQAKSSLSSQPEKS
LEDDPDYMRMRTENSSLIRKLEAARMDKESTKRDLNTRLHSMEREAALLKEERALLKSKMQNWSDYDDIKQELEV
LKSIEFSTGDDDEVRDRADNSAEKGDTLEKLLLSRNKKLSEELTILRVSHQDLHSRLASIQEELSGTKEELEKAQ
KLNEKLESDLANMQAEGASAFPSGVSVAGTYVTRAPTRKGRISPTSSIISGMDPRMLQEPMGGGSGILPMVTAQR
DRFKKKNAQLEQDLGEAHKTMRQLRQEVAALQKDNLNLYEKTRYVSTYNRGGATASSSSAYTANPNPSTVSMGGT
GNPGMSLDRYRKAYESNLSPFAAFRGRESARAYRRMSFPERVVYSVTRMVLASRASRNLFAAYCVALHVLVFLSL
YWLGHSDLERHGSNFGSAAAAAAAGGEQGASLARGGTDHGQWQEDGFNG
Coding >Ophio5|7764
ATGGCCGACGCCGCCCAAGCGCCTGCGCCAGCGCCAGCCCCAGTTACGGGGCTGGCTTCAGACCCGGTCGAAGGG
GGAAACAAGTTTCAACGTGCCATCTCGGCATGGCGAAACGTCGACCTCACGACGTTGACAGCAAGTCTCGATAAC
ACGGCATCGGAGATTGTTACCTATCAACGGGACTCGACTGTGCAACGCAAGGACCTGGCCCAAAAGACCAAGGAG
TTTAGGAAGCTGGAAGACGCCTCCAAGCTGGCGGAGATCAAAGGTCTTCTCAAAGCCTACCAAACATTCATCGAT
CTCCTCACTACCCACACTAAATCTGTCAATTCTGCCTTCCTTCAGGCCTACACCTCGATATCCGATGCGCCCGAT
CCGTATCCGCTTCTCGAGGCCGCCGTGGACTCCATGCTCGTGACGGAAGAGACGCTCCCCAGGCTAACGGAAGAG
AACCAGCGGCTGCAAGAAAATGTGGTGAAGCTGACAACTCAGCTAGGAGATGCCGAATCAAAGCTGCAGGTCGAG
CGAGCCGCGCGCAAGGAGTCGGAAGATACACTTGAGGCTCGGGTCAAGGGCGTTGAATCGTCTTGGACTGCCGTG
TTGGATGAGAAGAGGGACAACTGGGAAGCCCGAGAGAGGAGCCTGGAGGAGAAGCTGGAAAACCAGGAACGCCTC
CTCAACGAGATGCGCGCGAGCTACGAGGTCGGTCAGCGTCTGGGCCTCAGCGGGGACGATGCGGACACACAGCGT
GGCAACGCCTCGAGCGCCGAGCTGGAGATGCTTCACTCAGAGCTCGAGCGCGCAGGCTCCAGACTGGCCGAGGTA
GAAGCACGGAACGAGCAGATGCGACTGGAGCTGGCTCAGGCCAAGTCTTCTCTGTCTTCCCAGCCCGAGAAATCA
CTCGAGGACGACCCGGACTACATGCGGATGCGGACCGAGAACTCGTCGTTGATCCGCAAGCTTGAGGCTGCCAGG
ATGGACAAGGAGAGCACCAAGCGGGATCTTAACACGCGCTTGCATTCGATGGAACGAGAGGCGGCACTGTTGAAG
GAGGAGAGAGCATTGCTCAAGTCCAAGATGCAGAATTGGAGCGACTACGACGACATTAAACAAGAGCTTGAAGTG
CTCAAGAGCATAGAGTTTTCTACCGGCGACGACGATGAAGTCCGCGACAGGGCGGACAACAGCGCGGAGAAGGGC
GACACGCTGGAAAAGCTCTTACTGTCGCGAAACAAGAAGCTCAGCGAAGAGCTCACCATTCTGCGCGTGTCCCAT
CAAGACCTCCACAGCAGGCTGGCGAGTATCCAAGAAGAGCTTTCGGGGACCAAAGAAGAACTGGAAAAGGCGCAA
AAGCTCAACGAGAAGCTAGAGAGCGACCTGGCCAACATGCAGGCCGAAGGAGCGAGTGCTTTTCCCTCGGGAGTG
TCTGTTGCCGGCACGTACGTGACACGTGCGCCGACTCGGAAAGGGAGGATTTCGCCGACGTCGTCCATCATCAGC
GGCATGGATCCGCGCATGTTGCAGGAGCCGATGGGCGGCGGATCCGGCATCCTGCCGATGGTGACGGCGCAGCGA
GACCGGTTCAAAAAGAAGAACGCGCAGCTGGAGCAGGACCTGGGCGAGGCGCACAAAACCATGCGACAGCTGCGG
CAGGAGGTGGCGGCCCTACAGAAGGACAACCTGAACCTGTACGAGAAGACGCGCTACGTTTCGACATACAACCGA
GGCGGGGCGACAGCATCGTCCTCGTCGGCCTACACGGCGAACCCTAACCCGTCGACGGTCTCGATGGGCGGGACT
GGCAACCCCGGCATGTCGCTGGACCGTTACCGTAAGGCATACGAGTCAAACCTATCGCCCTTTGCGGCTTTTCGG
GGCCGCGAGTCGGCGAGGGCGTATCGAAGGATGAGCTTCCCGGAGAGGGTTGTGTACTCGGTCACGAGGATGGTT
CTGGCGTCCCGGGCGAGCAGGAACCTGTTTGCGGCGTATTGCGTCGCGCTGCACGTCCTGGTCTTCTTGTCGTTA
TACTGGCTCGGGCACTCAGACTTGGAGAGGCATGGCAGCAACTTTGGGTCGGCGGCGGCGGCGGCGGCGGCGGGG
GGGGAACAGGGGGCTTCTTTGGCCAGGGGCGGCACAGATCACGGGCAATGGCAAGAGGACGGCTTCAACGGA
Transcript >Ophio5|7764
ATGGCCGACGCCGCCCAAGCGCCTGCGCCAGCGCCAGCCCCAGTTACGGGGCTGGCTTCAGACCCGGTCGAAGGG
GGAAACAAGTTTCAACGTGCCATCTCGGCATGGCGAAACGTCGACCTCACGACGTTGACAGCAAGTCTCGATAAC
ACGGCATCGGAGATTGTTACCTATCAACGGGACTCGACTGTGCAACGCAAGGACCTGGCCCAAAAGACCAAGGAG
TTTAGGAAGCTGGAAGACGCCTCCAAGCTGGCGGAGATCAAAGGTCTTCTCAAAGCCTACCAAACATTCATCGAT
CTCCTCACTACCCACACTAAATCTGTCAATTCTGCCTTCCTTCAGGCCTACACCTCGATATCCGATGCGCCCGAT
CCGTATCCGCTTCTCGAGGCCGCCGTGGACTCCATGCTCGTGACGGAAGAGACGCTCCCCAGGCTAACGGAAGAG
AACCAGCGGCTGCAAGAAAATGTGGTGAAGCTGACAACTCAGCTAGGAGATGCCGAATCAAAGCTGCAGGTCGAG
CGAGCCGCGCGCAAGGAGTCGGAAGATACACTTGAGGCTCGGGTCAAGGGCGTTGAATCGTCTTGGACTGCCGTG
TTGGATGAGAAGAGGGACAACTGGGAAGCCCGAGAGAGGAGCCTGGAGGAGAAGCTGGAAAACCAGGAACGCCTC
CTCAACGAGATGCGCGCGAGCTACGAGGTCGGTCAGCGTCTGGGCCTCAGCGGGGACGATGCGGACACACAGCGT
GGCAACGCCTCGAGCGCCGAGCTGGAGATGCTTCACTCAGAGCTCGAGCGCGCAGGCTCCAGACTGGCCGAGGTA
GAAGCACGGAACGAGCAGATGCGACTGGAGCTGGCTCAGGCCAAGTCTTCTCTGTCTTCCCAGCCCGAGAAATCA
CTCGAGGACGACCCGGACTACATGCGGATGCGGACCGAGAACTCGTCGTTGATCCGCAAGCTTGAGGCTGCCAGG
ATGGACAAGGAGAGCACCAAGCGGGATCTTAACACGCGCTTGCATTCGATGGAACGAGAGGCGGCACTGTTGAAG
GAGGAGAGAGCATTGCTCAAGTCCAAGATGCAGAATTGGAGCGACTACGACGACATTAAACAAGAGCTTGAAGTG
CTCAAGAGCATAGAGTTTTCTACCGGCGACGACGATGAAGTCCGCGACAGGGCGGACAACAGCGCGGAGAAGGGC
GACACGCTGGAAAAGCTCTTACTGTCGCGAAACAAGAAGCTCAGCGAAGAGCTCACCATTCTGCGCGTGTCCCAT
CAAGACCTCCACAGCAGGCTGGCGAGTATCCAAGAAGAGCTTTCGGGGACCAAAGAAGAACTGGAAAAGGCGCAA
AAGCTCAACGAGAAGCTAGAGAGCGACCTGGCCAACATGCAGGCCGAAGGAGCGAGTGCTTTTCCCTCGGGAGTG
TCTGTTGCCGGCACGTACGTGACACGTGCGCCGACTCGGAAAGGGAGGATTTCGCCGACGTCGTCCATCATCAGC
GGCATGGATCCGCGCATGTTGCAGGAGCCGATGGGCGGCGGATCCGGCATCCTGCCGATGGTGACGGCGCAGCGA
GACCGGTTCAAAAAGAAGAACGCGCAGCTGGAGCAGGACCTGGGCGAGGCGCACAAAACCATGCGACAGCTGCGG
CAGGAGGTGGCGGCCCTACAGAAGGACAACCTGAACCTGTACGAGAAGACGCGCTACGTTTCGACATACAACCGA
GGCGGGGCGACAGCATCGTCCTCGTCGGCCTACACGGCGAACCCTAACCCGTCGACGGTCTCGATGGGCGGGACT
GGCAACCCCGGCATGTCGCTGGACCGTTACCGTAAGGCATACGAGTCAAACCTATCGCCCTTTGCGGCTTTTCGG
GGCCGCGAGTCGGCGAGGGCGTATCGAAGGATGAGCTTCCCGGAGAGGGTTGTGTACTCGGTCACGAGGATGGTT
CTGGCGTCCCGGGCGAGCAGGAACCTGTTTGCGGCGTATTGCGTCGCGCTGCACGTCCTGGTCTTCTTGTCGTTA
TACTGGCTCGGGCACTCAGACTTGGAGAGGCATGGCAGCAACTTTGGGTCGGCGGCGGCGGCGGCGGCGGCGGGG
GGGGAACAGGGGGCTTCTTTGGCCAGGGGCGGCACAGATCACGGGCAATGGCAAGAGGACGGCTTCAACGGATAG
Gene >Ophio5|7764
ATGGCCGACGCCGCCCAAGCGCCTGCGCCAGCGCCAGCCCCAGTTACGGGGCTGGCTTCAGACCCGGTCGAAGGG
GGAAACAAGTTTCAACGTGCCATCTCGGCATGGCGAAGTACGCTCTTGTTGGCCGGCAAGGCCATCATGACGCAC
ATTTGCTGACGCGTTAGGGTAGACGTCGACCTCACGACGTTGACAGCAAGTCTCGATAACACGGCATCGGAGATT
GTTACCTATCAACGGGACTCGACTGTGCAACGCAAGGACCTGGCCCAAAAGACCAAGGAGTTTAGGAAGCTGGAA
GACGCCTCCAAGCTGGCGGAGATCAAAGGTCTTCTCAAAGGTACTGTATTCGCAGGGGGGAGGCGACGACGACGA
CTTGGCTAATCTTTACGCCCTCCAGCCTACCAAACATTCATCGATCTCCTCACTACCCACACTAAATCTGTCAAT
TCTGCCTTCCTTCAGGCCTACACCTCGATATCCGATGCGCCCGATCCGTATCCGCTTCTCGAGGCCGCCGTGGAC
TCCATGCTCGTGACGGAAGAGACGCTCCCCAGGCTAACGGAAGAGAACCAGCGGCTGCAAGAAAATGTGGTGAAG
CTGACAACTCAGCTAGGAGATGCCGAATCAAAGCTGCAGGTCGAGCGAGCCGCGCGCAAGGAGTCGGAAGATACA
CTTGAGGCTCGGGTCAAGGGCGTTGAATCGTCTTGGACTGCCGTGTTGGATGAGAAGAGGGACAACTGGGAAGCC
CGAGAGAGGAGCCTGGAGGAGAAGCTGGAAAACCAGGAACGCCTCCTCAACGAGATGCGCGCGAGCTACGAGGTC
GGTCAGCGTCTGGGCCTCAGCGGGGACGATGCGGACACACAGCGTGGCAACGCCTCGAGCGCCGAGCTGGAGATG
CTTCACTCAGAGCTCGAGCGCGCAGGCTCCAGACTGGCCGAGGTAGAAGCACGGAACGAGCAGATGCGACTGGAG
CTGGCTCAGGCCAAGTCTTCTCTGTCTTCCCAGCCCGAGAAATCACTCGAGGACGACCCGGACTACATGCGGATG
CGGACCGAGAACTCGTCGTTGATCCGCAAGCTTGAGGCTGCCAGGATGGACAAGGAGAGCACCAAGCGGGATCTT
AACACGCGCTTGCATTCGATGGAACGAGAGGCGGCACTGTTGAAGGAGGAGAGAGCATTGCTCAAGTCCAAGATG
CAGAATTGGAGCGACTACGACGACATTAAACAAGAGCTTGAAGTGCTCAAGAGCATAGAGTTTTCTACCGGCGAC
GACGATGAAGTCCGCGACAGGGCGGACAACAGCGCGGAGAAGGGCGACACGCTGGAAAAGCTCTTACTGTCGCGA
AACAAGAAGCTCAGCGAAGAGCTCACCATTCTGCGCGTGTCCCATCAAGACCTCCACAGCAGGCTGGCGAGTATC
CAAGAAGAGCTTTCGGGGACCAAAGAAGAACTGGAAAAGGCGCAAAAGCTCAACGAGAAGCTAGAGAGCGACCTG
GCCAACATGCAGGCCGAAGGAGCGAGTGCTTTTCCCTCGGGAGTGTCTGTTGCCGGCACGTACGTGACACGTGCG
CCGACTCGGAAAGGGAGGATTTCGCCGACGTCGTCCATCATCAGCGGCATGGATCCGCGCATGTTGCAGGAGCCG
ATGGGCGGCGGATCCGGCATCCTGCCGATGGTGACGGCGCAGCGAGACCGGTTCAAAAAGAAGAACGCGCAGCTG
GAGCAGGACCTGGGCGAGGCGCACAAAACCATGCGACAGCTGCGGCAGGAGGTGGCGGCCCTACAGAAGGACAAC
CTGAACCTGTACGAGAAGACGCGCTACGTTTCGACATACAACCGAGGCGGGGCGACAGCATCGTCCTCGTCGGCC
TACACGGCGAACCCTAACCCGTCGACGGTCTCGATGGGCGGGACTGGCAACCCCGGCATGTCGCTGGACCGTTAC
CGTAAGGCATACGAGTCAAACCTATCGCCCTTTGCGGCTTTTCGGGGCCGCGAGTCGGCGAGGGCGTATCGAAGG
ATGAGCTTCCCGGAGAGGGTTGTGTACTCGGTCACGAGGATGGTTCTGGCGTCCCGGGCGAGCAGGAACCTGTTT
GCGGCGTATTGCGTCGCGCTGCACGTCCTGGTCTTCTTGTCGTTATACTGGCTCGGGCACTCAGACTTGGAGAGG
CATGGCAGCAACTTTGGGTCGGCGGCGGCGGCGGCGGCGGCGGGGGGGGAACAGGGGGCTTCTTTGGCCAGGGGC
GGCACAGATCACGGGCAATGGCAAGAGGACGGCTTCAACGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail