Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7751
Gene name
Locationscaffold_789:3556..4583
Strand+
Gene length (bp)1027
Transcript length (bp)531
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.20 0.00 6.52
CcL In ants, during behavior modification 13.88 0.53 27.24
CcD In ants, recently dead 9.57 1.97 17.16

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.004639 yes
SC16a CcD 0.026978 yes
CcL CcD 0.430491 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7751
MDRALVVYFSPVFYPLAIVILMPSSIEPVVFCSCLLQANDSRPWNKREYRYIPKSPSASTDAANHDPPVAALSGI
AFVPASPVAAQLGRLAIPSKYSQAASCSTAALRSTRLVSTKTDSAFVSRSATLYRRMHGLGMTQPPRQHRLGFPQ
HLPSACRKGTRNDGNHVYRSISLLET
Coding >Ophio5|7751
ATGGATCGTGCTCTTGTCGTTTATTTCTCTCCTGTTTTCTACCCTCTCGCCATCGTCATCTTGATGCCCTCGTCC
ATCGAGCCCGTCGTCTTTTGCAGCTGCCTGCTACAAGCAAACGACTCGCGTCCCTGGAATAAGCGCGAGTATCGC
TACATCCCAAAATCCCCGTCAGCCTCGACCGACGCTGCCAATCATGATCCGCCCGTCGCAGCGCTGAGTGGTATT
GCTTTTGTACCCGCTTCGCCTGTCGCAGCCCAGCTCGGCCGTCTCGCGATACCCAGCAAATACTCCCAAGCCGCA
TCATGTAGTACCGCCGCTCTACGCTCTACCAGGCTCGTCAGCACCAAGACCGACTCGGCATTCGTTTCCCGCTCG
GCTACCCTATACCGTCGGATGCATGGACTCGGCATGACACAACCACCTCGACAACACCGACTAGGGTTTCCTCAA
CATCTACCTTCGGCCTGCAGGAAAGGCACAAGGAATGATGGAAATCATGTCTATCGATCGATCTCATTGCTCGAG
ACA
Transcript >Ophio5|7751
ATGGATCGTGCTCTTGTCGTTTATTTCTCTCCTGTTTTCTACCCTCTCGCCATCGTCATCTTGATGCCCTCGTCC
ATCGAGCCCGTCGTCTTTTGCAGCTGCCTGCTACAAGCAAACGACTCGCGTCCCTGGAATAAGCGCGAGTATCGC
TACATCCCAAAATCCCCGTCAGCCTCGACCGACGCTGCCAATCATGATCCGCCCGTCGCAGCGCTGAGTGGTATT
GCTTTTGTACCCGCTTCGCCTGTCGCAGCCCAGCTCGGCCGTCTCGCGATACCCAGCAAATACTCCCAAGCCGCA
TCATGTAGTACCGCCGCTCTACGCTCTACCAGGCTCGTCAGCACCAAGACCGACTCGGCATTCGTTTCCCGCTCG
GCTACCCTATACCGTCGGATGCATGGACTCGGCATGACACAACCACCTCGACAACACCGACTAGGGTTTCCTCAA
CATCTACCTTCGGCCTGCAGGAAAGGCACAAGGAATGATGGAAATCATGTCTATCGATCGATCTCATTGCTCGAG
ACATGA
Gene >Ophio5|7751
ATGGATCGTGCTCTTGTCGTTTATTGTACGACTAACCCTTTAGCATGGGCTCCCTTTTTTTTTCTTTTTTTTTTC
ATATCCGTCTCATCTCACTCTCTACACCTACCTAGTCTCTCCTGTTTTCTACCCTCTCGCCATCGTCATCTTGAT
GCCCTCGTCCATCGAGCCCGTCGTCTTTTGCAGCTGCCTGCGTCAGTCGTCGGACGAGCCCCGTCGAGACTAAAA
AAGAAAAGAAACAAAAAAGAGAAACAAAGTCCCGCTCCATGCAAACATCATGCGCCAGTACAAGCAAACGACTCG
CGTCCCTGGAATAAGCGCGAGTATCGCTACATCCCAAAATCCCCGTCAGCCTCGACCGACGCTGCCAATCATGAT
CCGCCCGTCGCAGCGCTGAGTGGTATTGCTTTTGTACCCGCTTCGCCTGTCGCAGCCCAGCTCGGCCGTCTCGCG
ATACCCAGCAAATACTCCCAAGCCGCATCATGTAGTACCGGTACGCAAGTCCAATCGAACGGCTCGTCCCTTGAA
AAAAGGCCGCTAAAACTCGGATCCGTTGGCCGATGATGCTGCTCTGCTCGGCTGGCCGGCACTGGCACGGCTAAT
TCTTGCCGGTCAGCCGCTCTACGCTCTACCAGGTACTTATCGCTGGTCTTGAAGTCTGCCTTCTTGTCGTCCTTT
GCCCTTTGCCTTCTTCTCTGCTCACTGCCTCTGCCCACTGCTCTTCTCCCTTCTCTACTTTCGCTCTCCGCCGTC
ATCGTGTATTCGATCCGAAAGAAGCCATTGCCGCTTTCCGCATTTGGCCTGTGGATATCCCCCCTGATGCTCATT
TAGGCTCGTCAGCACCAAGACCGACTCGGCATTCGTTTCCCGCTCGGCTACCCTATACCGTCGGATGCATGGACT
CGGCATGACACAACCACCTCGACAACACCGACTAGGGTTTCCTCAACATCTACCTTCGGCCTGCAGGAAAGGCAC
AAGGAATGATGGAAATCATGTCTATCGATCGATCTCATTGCTCGAGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail