Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7750
Gene name
Locationscaffold_789:539..3268
Strand-
Gene length (bp)2729
Transcript length (bp)2598
Coding sequence length (bp)2595
Protein length (aa) 865

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 9.2E-170 150 822

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 129 860 4.0E-152
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 21 865 5.0E-141
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 129 859 6.0E-120
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 108 847 3.0E-116
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 129 834 1.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 129 860 4.0E-152
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 21 865 5.0E-141
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 129 859 6.0E-120
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 108 847 3.0E-116
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 129 834 1.0E-114
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 54 859 7.0E-114
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 132 847 1.0E-108
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 130 849 2.0E-107
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 130 855 5.0E-107
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 109 855 5.0E-100
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 135 847 4.0E-95
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 113 847 2.0E-94
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 135 847 1.0E-91
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 135 847 1.0E-88
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 226 248 22
3 261 283 22
4 287 309 22
5 330 352 22
6 409 431 22
7 478 500 22
8 545 567 22
9 572 591 19
10 653 675 22
11 688 710 22
12 720 742 22
13 749 768 19
14 772 789 17
15 802 824 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7750
MADDEKAVGGRRRSLSAPNKSRESAPFSYDEDDDDDVCASRLRSATEHDLNVTEDDLLEAKELASQYTLEQVRDI
MLRVRRVHEKDPNFPAAVIHKIQAFLGNDAVFSRPEKHQHLIQEMKLEAALVTSNSPYAEVRAVVSNKDLPATPC
STIRSWAIGLVFAVLLAFVNQLFEIRQPAIRVMANVAQLLAYPMGKAAENWLPDRGLTLFGVRHSLNPGPFSKKE
HMLITIMANVAYNTPYTNYIIWVQFLPQYFDQPYASHFAYQLLIALATNFIGYGIAGVCRRFLVYPSYCVWPASL
VTIALNSAFHTDVNPPVQGPLRRIWRISRIRFFYLMFACMFLWFWLPGYIWVGLSKFNWLGWIAPANRDLNVVTG
INHGLGVNPFPTWDWNVLLWDSADPLMVPFFSTLNRFIGVFASFWLVLALWYNNVFNTGYLPINTNRVYDHFAQL
YNITRATDDHGLFNQEKYAEYSPPFLGAGNLVIYVFFFGIYTSTLTYAVLYHRHEIAMGFKALYGSLRRKTPPRD
ARALDVHNRLMRAYPEVPDWWYVACLACAIAFGIAAIAGWNTHTSPVVVLYGLALCVVFVIPVGIIKAMTGIEVT
LNVLAEFVGGSWVDGNALAMNYFKSFGYVTCAHAIWFCNDLKLAHYVKIPPRHTFSAQMVATFVSTLVCIGVLNF
QMLNIDDVCTPYAQYKLTCPGVNTFFTASVLWGTVGPDRIFGHRGQYSAALVGFPLGVVIVVFFWALGKRFPRWA
WVRQIHPVAIMYGGIVWAPYNMSYVWPSVPIAWFSWIYLKSRYLGLWSKYNFVLSAAWSCGIAIAGIIIFFALQY
TGTDLDWWGNRIVETGCEGKACTLKTLAPGEYFGPRVGDF
Coding >Ophio5|7750
ATGGCCGACGACGAAAAGGCCGTCGGCGGCCGGCGCCGTTCCCTCTCGGCGCCGAACAAGTCCCGGGAAAGCGCG
CCCTTCTCGTACGATGAGGACGACGACGACGACGTCTGTGCTAGTCGGCTACGCTCCGCCACCGAACACGATCTC
AACGTGACGGAAGACGACCTCCTCGAGGCCAAGGAGCTCGCTTCGCAATATACGCTCGAACAAGTGCGAGACATC
ATGCTGCGCGTCCGCCGCGTGCACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATTCACAAGATACAGGCCTTC
CTCGGCAACGACGCCGTCTTCTCCCGTCCCGAGAAACATCAGCACCTCATCCAGGAGATGAAGCTCGAGGCCGCC
CTCGTCACCAGCAATAGCCCCTACGCCGAGGTGCGCGCCGTCGTCAGCAACAAGGACCTGCCTGCCACGCCCTGC
TCCACCATTCGCTCCTGGGCCATCGGCCTCGTCTTCGCCGTCCTGCTCGCCTTCGTCAACCAGCTCTTCGAGATC
CGCCAGCCCGCCATCCGTGTCATGGCAAACGTCGCCCAGCTGCTGGCCTACCCCATGGGCAAGGCCGCCGAGAAC
TGGCTGCCCGATCGCGGCTTGACTCTCTTCGGCGTCCGTCACTCCCTTAACCCGGGGCCCTTTTCCAAAAAGGAG
CACATGCTCATCACCATCATGGCCAACGTCGCCTACAACACTCCCTACACCAACTACATCATCTGGGTCCAGTTC
CTGCCCCAGTACTTTGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTGCTCATTGCCCTCGCCACAAACTTC
ATCGGCTATGGCATCGCCGGCGTCTGCCGCCGCTTCCTCGTCTACCCCTCGTATTGCGTCTGGCCCGCCTCGCTC
GTCACCATCGCTCTCAACTCGGCCTTCCACACCGACGTCAACCCCCCCGTCCAGGGGCCCCTGCGCCGCATCTGG
CGCATCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCTTGCATGTTCCTCTGGTTCTGGCTCCCCGGCTACATC
TGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATCGCCCCGGCCAACCGTGACCTCAACGTCGTCACCGGC
ATCAACCACGGCCTCGGCGTCAACCCCTTTCCCACCTGGGACTGGAACGTTTTGCTCTGGGACTCGGCCGACCCG
CTCATGGTGCCCTTCTTCAGTACTCTGAACCGCTTCATCGGCGTCTTCGCCTCCTTTTGGCTCGTCCTCGCCCTC
TGGTACAACAACGTCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTCGCCCAGCTC
TACAACATCACCCGCGCCACCGACGACCACGGCCTCTTCAACCAGGAAAAGTACGCCGAATACTCGCCTCCCTTT
CTCGGCGCCGGCAACCTCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTCACCTACGCCGTCCTC
TATCACCGTCACGAGATCGCCATGGGCTTCAAGGCCCTCTACGGCAGCCTGCGCCGCAAGACTCCCCCCCGAGAC
GCCCGCGCGCTCGACGTCCACAACCGCCTGATGCGCGCCTACCCGGAGGTGCCCGACTGGTGGTACGTGGCCTGC
CTGGCCTGCGCCATCGCCTTTGGCATCGCCGCCATCGCCGGCTGGAACACGCACACGTCGCCCGTCGTCGTCTTG
TACGGCCTCGCTCTGTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAGGTGACG
CTCAACGTCCTGGCCGAGTTCGTCGGCGGCTCCTGGGTCGACGGCAACGCCCTGGCCATGAACTACTTCAAGTCG
TTTGGCTACGTCACCTGCGCGCACGCCATATGGTTCTGCAACGACCTGAAGCTGGCCCACTACGTCAAGATACCG
CCCCGGCACACCTTTTCCGCGCAGATGGTGGCCACGTTTGTGAGCACCCTGGTCTGCATCGGCGTCCTCAACTTC
CAGATGCTCAACATCGACGACGTCTGCACCCCTTACGCTCAGTACAAGCTGACGTGCCCGGGCGTCAACACCTTC
TTCACCGCCTCGGTCCTCTGGGGCACCGTCGGCCCGGACCGCATCTTTGGCCACCGCGGCCAGTACAGCGCCGCC
CTGGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGCGCTCGGCAAGCGCTTTCCCCGCTGGGCC
TGGGTCCGCCAGATCCATCCCGTCGCCATCATGTACGGCGGCATCGTCTGGGCGCCTTACAACATGTCGTACGTC
TGGCCGTCGGTGCCCATTGCCTGGTTCTCGTGGATCTATCTCAAGTCGCGCTATCTCGGCCTGTGGTCCAAGTAC
AACTTTGTGCTCTCGGCCGCCTGGTCGTGCGGCATCGCCATAGCCGGCATCATCATCTTCTTCGCCCTGCAGTAC
ACGGGCACCGATTTGGACTGGTGGGGGAACCGGATCGTCGAGACGGGCTGCGAGGGCAAGGCCTGCACGCTCAAG
ACGCTGGCCCCGGGCGAGTATTTCGGGCCGCGCGTGGGCGACTTT
Transcript >Ophio5|7750
ATGGCCGACGACGAAAAGGCCGTCGGCGGCCGGCGCCGTTCCCTCTCGGCGCCGAACAAGTCCCGGGAAAGCGCG
CCCTTCTCGTACGATGAGGACGACGACGACGACGTCTGTGCTAGTCGGCTACGCTCCGCCACCGAACACGATCTC
AACGTGACGGAAGACGACCTCCTCGAGGCCAAGGAGCTCGCTTCGCAATATACGCTCGAACAAGTGCGAGACATC
ATGCTGCGCGTCCGCCGCGTGCACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATTCACAAGATACAGGCCTTC
CTCGGCAACGACGCCGTCTTCTCCCGTCCCGAGAAACATCAGCACCTCATCCAGGAGATGAAGCTCGAGGCCGCC
CTCGTCACCAGCAATAGCCCCTACGCCGAGGTGCGCGCCGTCGTCAGCAACAAGGACCTGCCTGCCACGCCCTGC
TCCACCATTCGCTCCTGGGCCATCGGCCTCGTCTTCGCCGTCCTGCTCGCCTTCGTCAACCAGCTCTTCGAGATC
CGCCAGCCCGCCATCCGTGTCATGGCAAACGTCGCCCAGCTGCTGGCCTACCCCATGGGCAAGGCCGCCGAGAAC
TGGCTGCCCGATCGCGGCTTGACTCTCTTCGGCGTCCGTCACTCCCTTAACCCGGGGCCCTTTTCCAAAAAGGAG
CACATGCTCATCACCATCATGGCCAACGTCGCCTACAACACTCCCTACACCAACTACATCATCTGGGTCCAGTTC
CTGCCCCAGTACTTTGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTGCTCATTGCCCTCGCCACAAACTTC
ATCGGCTATGGCATCGCCGGCGTCTGCCGCCGCTTCCTCGTCTACCCCTCGTATTGCGTCTGGCCCGCCTCGCTC
GTCACCATCGCTCTCAACTCGGCCTTCCACACCGACGTCAACCCCCCCGTCCAGGGGCCCCTGCGCCGCATCTGG
CGCATCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCTTGCATGTTCCTCTGGTTCTGGCTCCCCGGCTACATC
TGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATCGCCCCGGCCAACCGTGACCTCAACGTCGTCACCGGC
ATCAACCACGGCCTCGGCGTCAACCCCTTTCCCACCTGGGACTGGAACGTTTTGCTCTGGGACTCGGCCGACCCG
CTCATGGTGCCCTTCTTCAGTACTCTGAACCGCTTCATCGGCGTCTTCGCCTCCTTTTGGCTCGTCCTCGCCCTC
TGGTACAACAACGTCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTCGCCCAGCTC
TACAACATCACCCGCGCCACCGACGACCACGGCCTCTTCAACCAGGAAAAGTACGCCGAATACTCGCCTCCCTTT
CTCGGCGCCGGCAACCTCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTCACCTACGCCGTCCTC
TATCACCGTCACGAGATCGCCATGGGCTTCAAGGCCCTCTACGGCAGCCTGCGCCGCAAGACTCCCCCCCGAGAC
GCCCGCGCGCTCGACGTCCACAACCGCCTGATGCGCGCCTACCCGGAGGTGCCCGACTGGTGGTACGTGGCCTGC
CTGGCCTGCGCCATCGCCTTTGGCATCGCCGCCATCGCCGGCTGGAACACGCACACGTCGCCCGTCGTCGTCTTG
TACGGCCTCGCTCTGTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAGGTGACG
CTCAACGTCCTGGCCGAGTTCGTCGGCGGCTCCTGGGTCGACGGCAACGCCCTGGCCATGAACTACTTCAAGTCG
TTTGGCTACGTCACCTGCGCGCACGCCATATGGTTCTGCAACGACCTGAAGCTGGCCCACTACGTCAAGATACCG
CCCCGGCACACCTTTTCCGCGCAGATGGTGGCCACGTTTGTGAGCACCCTGGTCTGCATCGGCGTCCTCAACTTC
CAGATGCTCAACATCGACGACGTCTGCACCCCTTACGCTCAGTACAAGCTGACGTGCCCGGGCGTCAACACCTTC
TTCACCGCCTCGGTCCTCTGGGGCACCGTCGGCCCGGACCGCATCTTTGGCCACCGCGGCCAGTACAGCGCCGCC
CTGGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGCGCTCGGCAAGCGCTTTCCCCGCTGGGCC
TGGGTCCGCCAGATCCATCCCGTCGCCATCATGTACGGCGGCATCGTCTGGGCGCCTTACAACATGTCGTACGTC
TGGCCGTCGGTGCCCATTGCCTGGTTCTCGTGGATCTATCTCAAGTCGCGCTATCTCGGCCTGTGGTCCAAGTAC
AACTTTGTGCTCTCGGCCGCCTGGTCGTGCGGCATCGCCATAGCCGGCATCATCATCTTCTTCGCCCTGCAGTAC
ACGGGCACCGATTTGGACTGGTGGGGGAACCGGATCGTCGAGACGGGCTGCGAGGGCAAGGCCTGCACGCTCAAG
ACGCTGGCCCCGGGCGAGTATTTCGGGCCGCGCGTGGGCGACTTTTAG
Gene >Ophio5|7750
ATGGCCGACGACGAAAAGGCCGTCGGCGGCCGGCGCCGTTCCCTCTCGGCGCCGAACAAGTCCCGGGAAAGCGCG
GTGAGCGTCGTGACGGCCGTCGCCATCACATTGGTTTCCTTACTGAACAGCAGGAGCCCTTCTCGTACGATGAGG
ACGACGACGACGACGTCTGTGCTAGTCGGCTACGCTCCGCCACCGAACACGATCTCAACGTGACGGAAGACGACC
TCCTCGAGGCCAAGGAGCTCGCTTCGCAATATACGCTCGAACAAGTGCGAGACATCATGCTGCGCGTCCGCCGCG
TGCACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATTCACAAGATACAGGCCTTCCTCGGCAACGACGCCGTCT
TCTCCCGTCCCGAGAAACATCAGCACCTCATCCAGGAGATGAAGCTCGAGGCCGCCCTCGTCACCAGCAATAGCC
CCTACGCCGAGGTGCGCGCCGTCGTCAGCAACAAGGACCTGCCTGCCACGCCCTGCTCCACCATTCGCTCCTGGG
CCATCGGCCTCGTCTTCGCCGTCCTGCTCGCCTTCGTCAACCAGCTCTTCGAGATCCGCCAGCCCGCCATCCGTG
TCATGGCAAACGTCGCCCAGCTGCTGGCCTACCCCATGGGCAAGGCCGCCGAGAACTGGCTGCCCGATCGCGGCT
TGACTCTCTTCGGCGTCCGTCACTCCCTTAACCCGGGGCCCTTTTCCAAAAAGGAGCACATGCTCATCACCATCA
TGGCCAACGTCGCCTACAACACTCCCTACACCAACTACATCATCTGGGTCCAGTTCCTGCCCCAGTACTTTGACC
AGCCCTACGCCTCCCACTTCGCCTACCAGCTGCTCATTGCCCTCGCCACAAACTTCATCGGCTATGGCATCGCCG
GCGTCTGCCGCCGCTTCCTCGTCTACCCCTCGTATTGCGTCTGGCCCGCCTCGCTCGTCACCATCGCTCTCAACT
CGGCCTTCCACACCGACGTCAACCCCCCCGTCCAGGGGCCCCTGCGCCGCATCTGGCGCATCTCGCGCATCCGCT
TCTTCTACCTCATGTTCGCTTGCATGTTCCTCTGGTTCTGGCTCCCCGGCTACATCTGGGTCGGCCTGTCCAAGT
TCAACTGGCTCGGCTGGATCGCCCCGGCCAACCGTGACCTCAACGTCGTCACCGGCATCAACCACGGCCTCGGCG
TCAACCCCTTTCCCACCTGGGACTGGAACGTTTTGCTCTGGGACTCGGCCGACCCGCTCATGGTGCCCTTCTTCA
GTACTCTGAACCGCTTCATCGGCGTCTTCGCCTCCTTTTGGCTCGTCCTCGCCCTCTGGTACAACAACGTCTTCA
ACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTCGCCCAGCTCTACAACATCACCCGCGCCA
CCGACGACCACGGCCTCTTCAACCAGGAAAAGTACGCCGAATACTCGCCTCCCTTTCTCGGCGCCGGCAACCTCG
TCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTCACCTACGCCGTCCTCTATCACCGTCACGAGATCG
CCATGGGCTTCAAGGCCCTCTACGGCAGCCTGCGCCGCAAGACTCCCCCCCGAGACGCCCGCGCGCTCGACGTCC
ACAACCGCCTGATGCGCGCCTACCCGGAGGTGCCCGACTGGTGGTACGTGGCCTGCCTGGCCTGCGCCATCGCCT
TTGGCATCGCCGCCATCGCCGGCTGGAACACGCACACGTCGCCCGTCGTCGTCTTGTACGGCCTCGCTCTGTGCG
TCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAGGTGACGCTCAACGTCCTGGCCGAGT
TCGTCGGCGGCTCCTGGGTCGACGGCAACGCCCTGGCCATGAACTACTTCAAGTCGTTTGGCTACGTCACCTGCG
CGCACGCCATATGGTTCTGCAACGACCTGAAGCTGGCCCACTACGTCAAGATACCGCCCCGGCACACCTTTTCCG
CGCAGATGGTGGCCACGTTTGTGAGCACCCTGGTCTGCATCGGCGTCCTCAACTTCCAGATGCTCAACATCGACG
ACGTCTGCACCCCTTACGCTCAGTACAAGCTGACGTGCCCGGGCGTCAACACCTTCTTCACCGCCTCGGTCCTCT
GGGGCACCGTCGGCCCGGACCGCATCTTTGGCCACCGCGGCCAGTACAGCGCCGCCCTGGTCGGCTTCCCCCTCG
GCGTCGTCATCGTCGTCTTCTTCTGGGCGCTCGGCAAGCGCTTTCCCCGCTGGGCCTGGGTCCGCCAGATCCATC
CCGTCGCCATCATGTACGGCGGCATCGTCTGGGCGCCTTACAACATGTCGTACGTCTGGCCGTCGGTGCCCATTG
CCTGGTTCTCGTGGATCTATCTCAAGTCGCGCTATCTCGGCCTGTGGTCCAAGGTACATACATGTGTCTGCCCCG
AGGGGCCTTCCCCCCCCCCCTAAAGGCCCCGGGCAGCCGCTGACTGGTCTCAGTACAACTTTGTGCTCTCGGCCG
CCTGGTCGTGCGGCATCGCCATAGCCGGCATCATCATCTTCTTCGCCCTGCAGTACACGGGCACCGATTTGGACT
GGTGGGGGAACCGGATCGTCGAGACGGGCTGCGAGGGCAAGGCCTGCACGCTCAAGACGCTGGCCCCGGGCGAGT
ATTTCGGGCCGCGCGTGGGCGACTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail