Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7749
Gene name
Locationscaffold_788:5802..6566
Strand-
Gene length (bp)764
Transcript length (bp)618
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07335 Glyco_hydro_75 Fungal chitosanase of glycosyl hydrolase group 75 1.1E-64 1 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WB37|CSN_ASPFU Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn PE=3 SV=1 1 174 3.0E-52
sp|Q9P961|CSN_ASPOZ Endo-chitosanase OS=Aspergillus oryzae GN=csn PE=1 SV=1 1 170 2.0E-48
sp|Q2U3M5|CSN_ASPOR Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=csn PE=3 SV=1 1 170 2.0E-48
sp|Q875I9|CSN_ASPFM Endo-chitosanase OS=Neosartorya fumigata GN=csn PE=1 SV=1 1 170 4.0E-46
sp|Q2U1H5|CSNB_ASPOR Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=csnB PE=3 SV=1 1 170 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WB37|CSN_ASPFU Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn PE=3 SV=1 1 174 3.0E-52
sp|Q9P961|CSN_ASPOZ Endo-chitosanase OS=Aspergillus oryzae GN=csn PE=1 SV=1 1 170 2.0E-48
sp|Q2U3M5|CSN_ASPOR Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=csn PE=3 SV=1 1 170 2.0E-48
sp|Q875I9|CSN_ASPFM Endo-chitosanase OS=Neosartorya fumigata GN=csn PE=1 SV=1 1 170 4.0E-46
sp|Q2U1H5|CSNB_ASPOR Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=csnB PE=3 SV=1 1 170 4.0E-41
sp|Q8NK76|CSNB_ASPOZ Endo-chitosanase B OS=Aspergillus oryzae GN=csnB PE=3 SV=1 1 170 3.0E-35
sp|Q75R32|CSNC_ASPOZ Endo-chitosanase C OS=Aspergillus oryzae GN=csnC PE=1 SV=2 1 174 1.0E-12
sp|Q2U5P1|CSNC_ASPOR Endo-chitosanase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=csnC PE=3 SV=1 1 174 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016977 chitosanase activity Yes
GO:0016787 hydrolase activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7749
MDIDCDGDQKPTTANDNRCEASTDTQARTRFREKVRRYGIPDLNPHVHTYVVFGNEGSKPRWPVFDPQQQGIKPL
SVMAVVCNNKLIYGVWGDTNGDDGSQAMVGEASISLATACFGDSMTGGNGHNGNDILYLAFPGRDAVPGAHGADW
NASTFQQFERSLAPVGDRLLRRIAIPKKSLAMPTHTIRPALTLLVALVAFASLGA
Coding >Ophio5|7749
ATGGACATCGACTGCGACGGCGACCAAAAGCCGACTACTGCCAACGACAACCGCTGCGAAGCCTCGACAGACACG
CAGGCCAGGACCAGGTTCCGGGAAAAGGTCAGGCGCTACGGCATCCCCGACCTCAACCCCCACGTCCACACCTAC
GTCGTCTTCGGAAACGAAGGCTCTAAGCCGCGATGGCCCGTCTTTGATCCTCAGCAACAGGGTATCAAGCCCTTG
AGCGTCATGGCCGTCGTCTGCAACAACAAGCTGATCTACGGCGTCTGGGGCGACACAAACGGCGACGACGGCTCC
CAAGCCATGGTCGGCGAAGCCTCCATCTCGCTCGCAACCGCCTGCTTCGGCGACTCCATGACGGGCGGAAACGGC
CACAACGGAAACGATATTCTCTACCTGGCCTTTCCCGGCCGTGACGCCGTCCCCGGTGCCCACGGCGCCGACTGG
AACGCGTCCACCTTTCAACAGTTTGAGCGCAGTCTCGCCCCCGTCGGCGATCGCCTGCTTCGTCGCATCGCCATC
CCCAAAAAGTCTTTGGCCATGCCCACCCATACCATTCGTCCGGCCCTTACCTTGTTGGTCGCTCTCGTCGCATTC
GCTAGTCTCGGGGCC
Transcript >Ophio5|7749
ATGGACATCGACTGCGACGGCGACCAAAAGCCGACTACTGCCAACGACAACCGCTGCGAAGCCTCGACAGACACG
CAGGCCAGGACCAGGTTCCGGGAAAAGGTCAGGCGCTACGGCATCCCCGACCTCAACCCCCACGTCCACACCTAC
GTCGTCTTCGGAAACGAAGGCTCTAAGCCGCGATGGCCCGTCTTTGATCCTCAGCAACAGGGTATCAAGCCCTTG
AGCGTCATGGCCGTCGTCTGCAACAACAAGCTGATCTACGGCGTCTGGGGCGACACAAACGGCGACGACGGCTCC
CAAGCCATGGTCGGCGAAGCCTCCATCTCGCTCGCAACCGCCTGCTTCGGCGACTCCATGACGGGCGGAAACGGC
CACAACGGAAACGATATTCTCTACCTGGCCTTTCCCGGCCGTGACGCCGTCCCCGGTGCCCACGGCGCCGACTGG
AACGCGTCCACCTTTCAACAGTTTGAGCGCAGTCTCGCCCCCGTCGGCGATCGCCTGCTTCGTCGCATCGCCATC
CCCAAAAAGTCTTTGGCCATGCCCACCCATACCATTCGTCCGGCCCTTACCTTGTTGGTCGCTCTCGTCGCATTC
GCTAGTCTCGGGGCCTGA
Gene >Ophio5|7749
ATGGACATCGACTGCGACGGCGACCAAAAGCCGACTACTGCCAACGACAACCGCTGCGAAGCCTCGACAGACACG
CAGGCCAGGACCAGGTTCCGGGAAAAGGTCAGGCGCTACGGCATCCCCGACCTCAACCCCCACGTCCACACCTAC
GTCGTCTTCGGAAACGAAGGCTCTAAGCCGCGATGGCCCGTCTTTGATCCTCAGCAACAGGGTATCAAGCCCTTG
AGCGTCATGGCCGTCGTCTGCAACAACAAGCTGGTTCGTCCTTCCCCCCTTTTTCTTTTCTTCTCATCTCCTCCC
CCCTTTTCCCCCTTTTTACCTCTTCTTTCTCTTCTTCTCTTGTTTTTTTTTTAAACAAAAGAACAATCTCATATT
AAGAATTAATAAAATAAAAAAAAAAAAAGATCTACGGCGTCTGGGGCGACACAAACGGCGACGACGGCTCCCAAG
CCATGGTCGGCGAAGCCTCCATCTCGCTCGCAACCGCCTGCTTCGGCGACTCCATGACGGGCGGAAACGGCCACA
ACGGAAACGATATTCTCTACCTGGCCTTTCCCGGCCGTGACGCCGTCCCCGGTGCCCACGGCGCCGACTGGAACG
CGTCCACCTTTCAACAGTTTGAGCGCAGTCTCGCCCCCGTCGGCGATCGCCTGCTTCGTCGCATCGCCATCCCCA
AAAAGTCTTTGGCCATGCCCACCCATACCATTCGTCCGGCCCTTACCTTGTTGGTCGCTCTCGTCGCATTCGCTA
GTCTCGGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail