Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7748
Gene name
Locationscaffold_788:1896..4387
Strand+
Gene length (bp)2491
Transcript length (bp)2244
Coding sequence length (bp)2241
Protein length (aa) 747

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.5E-12 293 622
PF00083 Sugar_tr Sugar (and other) transporter 1.3E-11 326 735

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 251 747 5.0E-166
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 270 747 1.0E-26
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 274 745 2.0E-25
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 208 744 8.0E-24
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 245 744 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 251 747 5.0E-166
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 270 747 1.0E-26
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 274 745 2.0E-25
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 208 744 8.0E-24
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 245 744 6.0E-22
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 245 744 4.0E-20
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 208 744 1.0E-19
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 247 506 2.0E-15
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 247 506 2.0E-15
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 322 744 3.0E-14
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 266 744 2.0E-12
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 268 744 3.0E-12
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 323 743 3.0E-12
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 322 744 7.0E-12
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 326 744 2.0E-11
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 268 506 9.0E-11
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 261 744 1.0E-10
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 323 743 1.0E-10
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 326 744 2.0E-10
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 323 743 3.0E-10
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 323 743 3.0E-10
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 323 743 7.0E-10
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 268 506 8.0E-10
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 268 506 1.0E-09
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 192 506 2.0E-09
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 268 506 2.0E-09
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 268 538 2.0E-09
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 268 506 2.0E-09
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 268 506 2.0E-09
sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 297 743 4.0E-09
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 312 738 4.0E-09
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 328 715 7.0E-09
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 268 506 9.0E-09
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 481 725 1.0E-08
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 333 738 2.0E-08
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 320 738 2.0E-08
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 323 743 2.0E-08
sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 323 743 4.0E-08
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 329 738 4.0E-08
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 297 744 5.0E-08
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 455 725 6.0E-08
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 334 726 6.0E-08
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 297 744 7.0E-08
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 334 726 8.0E-08
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 481 738 9.0E-08
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 313 709 1.0E-07
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 297 744 1.0E-07
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 333 726 2.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 333 725 3.0E-07
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 268 507 3.0E-07
sp|Q5R5H7|S22A2_PONAB Solute carrier family 22 member 2 OS=Pongo abelii GN=SLC22A2 PE=2 SV=1 326 720 3.0E-07
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 333 738 4.0E-07
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 297 738 4.0E-07
sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Homo sapiens GN=SLC22A16 PE=1 SV=1 313 744 5.0E-07
sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 332 743 7.0E-07
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 323 743 7.0E-07
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 334 726 7.0E-07
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 326 720 8.0E-07
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 327 736 9.0E-07
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 268 663 1.0E-06
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 268 663 1.0E-06
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 313 709 1.0E-06
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 334 726 1.0E-06
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 481 738 1.0E-06
sp|Q17QN9|S22AG_BOVIN Solute carrier family 22 member 16 OS=Bos taurus GN=SLC22A16 PE=2 SV=2 481 738 1.0E-06
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 333 738 3.0E-06
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 333 743 3.0E-06
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 326 742 6.0E-06
sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 481 708 8.0E-06
sp|Q863T6|S22A1_PIG Solute carrier family 22 member 1 OS=Sus scrofa GN=SLC22A1 PE=2 SV=1 455 743 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 290 312 22
2 327 346 19
3 367 389 22
4 409 431 22
5 457 479 22
6 562 584 22
7 605 622 17
8 632 651 19
9 656 678 22
10 717 739 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7748
MEGSKLPSVDSTRKAPSSTARRKARAPHTSASRLPYPPIKNPHPYLVAPPFPPPSAHAAQSRGPREPWRHRVVGR
FTGSWRHDAASPIAVGLGSHLTPRVLPPSRIANRTLDLGPSHLPISSLSFVVLFFRPPPPRASSAFPLCLSRPNI
PLAGLVRPRLHWHQPHIRAPVPSGPVWPPVWPRLAPFNLSSGWARSASAYRLLASAPPLEPFASSSSSSFSSNMG
VENAVDELVPSPRDPPLYSSSIELASDGDSAIIPKGAIDPIYEAKARLLNRAIREMGMGWYQWQLFIVVGFGWAS
DNLWPVVTALIFTPITQEFHPDRPPLFTLAQNIGLLAGAAFWGFGCDVFGRKLGFNLTLGLTAFWGLVAASAPSF
AAIGFFACMWSFGVGGNLPVDSAVFLEFLPQSHQYLLTVLSIDWALAQVIANLIAWPLLTTFTCAQGQSQPCLKR
DNMGWRYFVLAMGGLTLLMFLIRFVFFTIYESPKYLVGKGRDADAVRVLHEVARRNRTSVTLTLDDLKACEPDGY
VAQTDTSAAVKRYMEKVDTKHVTALFAGRRLALSTGLIMAIWALIGLGYPLYNAFLPFIQATRGVQFQDGSNNIT
YRNSLIISVLGVPGAILGGFLVELPRIGRKGTLSIFTILTGVFLFCSTTAANSTALLGWNCAFNFCSNVMYAVLY
GYTPEIFPTPQRGTGNALCASCNRVFGIMAPIVAMFANLQTSAPVYGSGALFLTAGILVMLLPFESQGREAM
Coding >Ophio5|7748
ATGGAAGGCAGTAAGCTCCCGTCCGTCGACTCGACGAGGAAGGCACCTTCTAGTACGGCGAGAAGGAAGGCACGC
GCACCGCACACCTCCGCATCCCGCCTCCCATATCCCCCCATAAAAAATCCTCATCCTTACCTAGTCGCTCCCCCC
TTCCCCCCTCCCTCCGCCCATGCCGCCCAATCACGAGGCCCGAGAGAGCCATGGCGCCATCGAGTCGTTGGCCGC
TTCACCGGCTCATGGCGCCATGACGCTGCTTCGCCAATAGCCGTCGGTCTTGGGTCGCACCTCACACCTCGTGTT
CTTCCACCGTCCCGCATAGCGAACCGAACCCTGGACCTTGGTCCATCTCACTTACCTATTAGTAGCTTGTCGTTC
GTCGTCCTCTTTTTTCGCCCCCCCCCCCCCCGCGCTTCTTCAGCCTTTCCTCTTTGCCTCTCTCGGCCGAATATC
CCCCTAGCTGGTCTCGTCCGGCCTCGTCTACACTGGCATCAGCCTCATATCCGCGCTCCCGTCCCGTCTGGCCCC
GTCTGGCCTCCAGTCTGGCCCCGCCTGGCCCCGTTCAACCTCTCCAGCGGCTGGGCCCGTTCGGCCTCCGCTTAC
CGTCTCCTCGCCTCGGCGCCCCCTCTCGAGCCCTTCGCCTCGTCCTCGTCCTCGTCCTTCTCCTCCAATATGGGT
GTCGAAAATGCCGTCGACGAGCTCGTGCCGTCGCCTCGCGACCCTCCCTTGTACAGCAGCAGCATTGAGCTTGCG
TCGGACGGTGACTCGGCCATCATCCCCAAGGGCGCCATCGATCCCATCTACGAGGCCAAGGCCCGACTGCTCAAC
CGCGCCATTCGCGAAATGGGAATGGGTTGGTATCAATGGCAGCTCTTCATCGTCGTCGGCTTCGGCTGGGCCAGC
GATAACCTATGGCCTGTCGTCACCGCCCTCATCTTCACCCCCATAACCCAAGAGTTCCACCCCGATCGCCCGCCG
CTCTTCACCCTGGCCCAGAACATCGGCCTCCTCGCCGGCGCCGCCTTCTGGGGCTTCGGCTGCGACGTCTTTGGC
CGCAAGCTCGGCTTCAACCTGACGCTCGGCCTCACCGCCTTCTGGGGTCTCGTCGCCGCCAGCGCCCCCAGCTTC
GCCGCCATCGGCTTCTTCGCCTGCATGTGGTCCTTTGGCGTCGGCGGCAACCTCCCCGTCGACTCGGCCGTCTTC
CTCGAGTTCCTGCCGCAGAGCCACCAATATCTCCTGACGGTCCTGTCCATCGACTGGGCCCTCGCCCAGGTCATC
GCCAATCTTATCGCCTGGCCGCTCCTCACAACCTTTACCTGCGCCCAGGGCCAGTCGCAGCCGTGCCTCAAGCGT
GACAACATGGGCTGGCGCTACTTTGTCCTCGCCATGGGCGGCCTGACGCTCCTCATGTTCCTCATACGCTTCGTC
TTTTTCACCATATACGAGTCGCCCAAGTATCTCGTCGGCAAGGGCCGCGACGCCGACGCCGTCCGCGTCCTCCAC
GAGGTGGCCCGCCGCAACCGCACCTCCGTCACCCTGACACTCGATGACCTCAAGGCCTGCGAGCCCGACGGCTAC
GTCGCCCAGACGGACACGTCGGCCGCCGTCAAGAGGTACATGGAAAAGGTCGACACCAAGCACGTCACGGCCCTG
TTCGCCGGCCGCCGCCTGGCGCTGAGTACCGGTCTCATCATGGCCATATGGGCCCTCATCGGGCTCGGCTATCCC
CTCTACAACGCCTTCCTGCCTTTCATCCAGGCCACTAGGGGTGTCCAGTTCCAGGACGGGAGCAACAACATCACC
TACCGCAACAGTCTCATCATCTCCGTTCTCGGCGTCCCGGGCGCCATTCTCGGCGGGTTCCTCGTCGAGCTGCCT
CGCATCGGCCGCAAGGGCACCCTGTCCATCTTCACCATCCTCACCGGCGTCTTCCTCTTCTGCTCCACCACGGCC
GCCAACAGCACCGCCCTCCTCGGCTGGAACTGCGCCTTTAACTTCTGCAGCAACGTCATGTACGCTGTTCTCTAT
GGCTACACGCCCGAGATCTTTCCCACGCCCCAGCGCGGCACGGGCAACGCCCTCTGCGCTTCCTGCAACCGCGTC
TTTGGCATCATGGCTCCCATTGTCGCCATGTTCGCCAACCTGCAAACATCGGCACCCGTGTACGGCAGCGGCGCG
CTGTTCCTCACAGCAGGCATTCTCGTCATGTTGCTTCCATTTGAGTCACAAGGGAGAGAGGCGATG
Transcript >Ophio5|7748
ATGGAAGGCAGTAAGCTCCCGTCCGTCGACTCGACGAGGAAGGCACCTTCTAGTACGGCGAGAAGGAAGGCACGC
GCACCGCACACCTCCGCATCCCGCCTCCCATATCCCCCCATAAAAAATCCTCATCCTTACCTAGTCGCTCCCCCC
TTCCCCCCTCCCTCCGCCCATGCCGCCCAATCACGAGGCCCGAGAGAGCCATGGCGCCATCGAGTCGTTGGCCGC
TTCACCGGCTCATGGCGCCATGACGCTGCTTCGCCAATAGCCGTCGGTCTTGGGTCGCACCTCACACCTCGTGTT
CTTCCACCGTCCCGCATAGCGAACCGAACCCTGGACCTTGGTCCATCTCACTTACCTATTAGTAGCTTGTCGTTC
GTCGTCCTCTTTTTTCGCCCCCCCCCCCCCCGCGCTTCTTCAGCCTTTCCTCTTTGCCTCTCTCGGCCGAATATC
CCCCTAGCTGGTCTCGTCCGGCCTCGTCTACACTGGCATCAGCCTCATATCCGCGCTCCCGTCCCGTCTGGCCCC
GTCTGGCCTCCAGTCTGGCCCCGCCTGGCCCCGTTCAACCTCTCCAGCGGCTGGGCCCGTTCGGCCTCCGCTTAC
CGTCTCCTCGCCTCGGCGCCCCCTCTCGAGCCCTTCGCCTCGTCCTCGTCCTCGTCCTTCTCCTCCAATATGGGT
GTCGAAAATGCCGTCGACGAGCTCGTGCCGTCGCCTCGCGACCCTCCCTTGTACAGCAGCAGCATTGAGCTTGCG
TCGGACGGTGACTCGGCCATCATCCCCAAGGGCGCCATCGATCCCATCTACGAGGCCAAGGCCCGACTGCTCAAC
CGCGCCATTCGCGAAATGGGAATGGGTTGGTATCAATGGCAGCTCTTCATCGTCGTCGGCTTCGGCTGGGCCAGC
GATAACCTATGGCCTGTCGTCACCGCCCTCATCTTCACCCCCATAACCCAAGAGTTCCACCCCGATCGCCCGCCG
CTCTTCACCCTGGCCCAGAACATCGGCCTCCTCGCCGGCGCCGCCTTCTGGGGCTTCGGCTGCGACGTCTTTGGC
CGCAAGCTCGGCTTCAACCTGACGCTCGGCCTCACCGCCTTCTGGGGTCTCGTCGCCGCCAGCGCCCCCAGCTTC
GCCGCCATCGGCTTCTTCGCCTGCATGTGGTCCTTTGGCGTCGGCGGCAACCTCCCCGTCGACTCGGCCGTCTTC
CTCGAGTTCCTGCCGCAGAGCCACCAATATCTCCTGACGGTCCTGTCCATCGACTGGGCCCTCGCCCAGGTCATC
GCCAATCTTATCGCCTGGCCGCTCCTCACAACCTTTACCTGCGCCCAGGGCCAGTCGCAGCCGTGCCTCAAGCGT
GACAACATGGGCTGGCGCTACTTTGTCCTCGCCATGGGCGGCCTGACGCTCCTCATGTTCCTCATACGCTTCGTC
TTTTTCACCATATACGAGTCGCCCAAGTATCTCGTCGGCAAGGGCCGCGACGCCGACGCCGTCCGCGTCCTCCAC
GAGGTGGCCCGCCGCAACCGCACCTCCGTCACCCTGACACTCGATGACCTCAAGGCCTGCGAGCCCGACGGCTAC
GTCGCCCAGACGGACACGTCGGCCGCCGTCAAGAGGTACATGGAAAAGGTCGACACCAAGCACGTCACGGCCCTG
TTCGCCGGCCGCCGCCTGGCGCTGAGTACCGGTCTCATCATGGCCATATGGGCCCTCATCGGGCTCGGCTATCCC
CTCTACAACGCCTTCCTGCCTTTCATCCAGGCCACTAGGGGTGTCCAGTTCCAGGACGGGAGCAACAACATCACC
TACCGCAACAGTCTCATCATCTCCGTTCTCGGCGTCCCGGGCGCCATTCTCGGCGGGTTCCTCGTCGAGCTGCCT
CGCATCGGCCGCAAGGGCACCCTGTCCATCTTCACCATCCTCACCGGCGTCTTCCTCTTCTGCTCCACCACGGCC
GCCAACAGCACCGCCCTCCTCGGCTGGAACTGCGCCTTTAACTTCTGCAGCAACGTCATGTACGCTGTTCTCTAT
GGCTACACGCCCGAGATCTTTCCCACGCCCCAGCGCGGCACGGGCAACGCCCTCTGCGCTTCCTGCAACCGCGTC
TTTGGCATCATGGCTCCCATTGTCGCCATGTTCGCCAACCTGCAAACATCGGCACCCGTGTACGGCAGCGGCGCG
CTGTTCCTCACAGCAGGCATTCTCGTCATGTTGCTTCCATTTGAGTCACAAGGGAGAGAGGCGATGTGA
Gene >Ophio5|7748
ATGGAAGGCAGTAAGCTCCCGTCCGTCGACTCGACGAGGAAGGCACCTTCTAGTACGGCGAGAAGGAAGGCACGC
GCACCGCACACCTCCGCATCCCGCCTCCCATATCCCCCCATAAAAAATCCTCATCCTTACCTAGGTAGGTAGGGA
AAAGCAAAACCTCACACAACCTCCATCCAGCTTCTTCGTCGTCGAGCTGTCTGTCTGAGCCAAAACCGTCGGCCG
TTGCCTTGCCGCCCGAAGCGGCCGTCTCTCCCTTCCCAAAGTCGCTCCCCCCTTCCCCCCTCCCTCCGCCCATGC
CGCCCAATCACGAGGCCCGAGAGAGCCATGGCGCCATCGAGTCGTTGGCCGCTTCACCGGCTCATGGCGCCATGA
CGCTGCTTCGCCAATAGCCGTCGGTCTTGGGTCGCACCTCACACCTCGTGTTCTTCCACCGTCCCGCATAGCGAA
CCGAACCCTGGACCTTGGTCCATCTCACTTACCTATTAGTAGCTTGTCGTTCGTCGTCCTCTTTTTTCGCCCCCC
CCCCCCCCGCGCTTCTTCAGCCTTTCCTCTTTGCCTCTCTCGGCCGAATATCCCCCTAGCTGGTCTCGTCCGGCC
TCGTCTACACTGGCATCAGCCTCATATCCGCGCTCCCGTCCCGTCTGGCCCCGTCTGGCCTCCAGTCTGGCCCCG
CCTGGCCCCGTTCAACCTCTCCAGCGGCTGGGCCCGTTCGGCCTCCGCTTACCGTCTCCTCGCCTCGGCGCCCCC
TCTCGAGCCCTTCGCCTCGTCCTCGTCCTCGTCCTTCTCCTCCAATATGGGTGTCGAAAATGCCGTCGACGAGCT
CGTGCCGTCGCCTCGCGACCCTCCCTTGTACAGCAGCAGCATTGAGCTTGCGTCGGACGGTGACTCGGCCATCAT
CCCCAAGGGCGCCATCGATCCCATCTACGAGGCCAAGGCCCGACTGCTCAACCGCGCCGTGCGTTCGCCCCTGCC
CTCTTGAGTCGAATGTCGAGGCCGCTGACCTTGTCGCCTACTCCAGATTCGCGAAATGGGAATGGGTTGGTATCA
ATGGCAGCTCTTCATCGTCGTCGGCTTCGGCTGGGCCAGCGATAACCTATGGCCTGTCGTCACCGCCCTCATCTT
CACCCCCATAACCCAAGAGTTCCACCCCGATCGCCCGCCGCTCTTCACCCTGGCCCAGAACATCGGCCTCCTCGC
CGGCGCCGCCTTCTGGGGCTTCGGCTGCGACGTCTTTGGCCGCAAGCTCGGCTTCAACCTGACGCTCGGCCTCAC
CGCCTTCTGGGGTCTCGTCGCCGCCAGCGCCCCCAGCTTCGCCGCCATCGGCTTCTTCGCCTGCATGTGGTCCTT
TGGCGTCGGCGGCAACCTCCCCGTCGACTCGGCCGTCTTCCTCGAGTTCCTGCCGCAGAGCCACCAATATCTCCT
GACGGTCCTGTCCATCGACTGGGCCCTCGCCCAGGTCATCGCCAATCTTATCGCCTGGCCGCTCCTCACAACCTT
TACCTGCGCCCAGGGCCAGTCGCAGCCGTGCCTCAAGCGTGACAACATGGGCTGGCGCTACTTTGTCCTCGCCAT
GGGCGGCCTGACGCTCCTCATGTTCCTCATACGCTTCGTCTTTTTCACCATATACGAGTCGCCCAAGTATCTCGT
CGGCAAGGGCCGCGACGCCGACGCCGTCCGCGTCCTCCACGAGGTGGCCCGCCGCAACCGCACCTCCGTCACCCT
GACACTCGATGACCTCAAGGCCTGCGAGCCCGACGGCTACGTCGCCCAGACGGACACGTCGGCCGCCGTCAAGAG
GTACATGGAAAAGGTCGACACCAAGCACGTCACGGCCCTGTTCGCCGGCCGCCGCCTGGCGCTGAGTACCGGTCT
CATCATGGCCATATGGGCCCTCATCGGGCTCGGCTATCCCCTCTACAACGCCTTCCTGCCTTTCATCCAGGCCAC
TAGGGGTGTCCAGTTCCAGGACGGGAGCAACAACATCACCTACCGCAACAGTCTCATCATCTCCGTTCTCGGCGT
CCCGGGCGCCATTCTCGGCGGGTTCCTCGTCGAGCTGCCTCGCATCGGCCGCAAGGGCACCCTGTCCATCTTCAC
CATCCTCACCGGCGTCTTCCTCTTCTGCTCCACCACGGCCGCCAACAGCACCGCCCTCCTCGGCTGGAACTGCGC
CTTTAACTTCTGCAGCAACGTCATGTACGCTGTTCTCTATGGCTACACGCCCGAGATCTTTCCCACGCCCCAGCG
CGGCACGGGCAACGCCCTCTGCGCTTCCTGCAACCGCGTCTTTGGCATCATGGCTGTGAGTACTGTGAAGATGTT
ACGAGGCTGTTCGTTTCAGGGGCTTACTCTTTGACAGCCCATTGTCGCCATGTTCGCCAACCTGCAAACATCGGC
ACCCGTGTACGGCAGCGGCGCGCTGTTCCTCACAGCAGGCATTCTCGTCATGTTGCTTCCATTTGAGTCACAAGG
GAGAGAGGCGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail