Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7746
Gene name
Locationscaffold_787:2673..4781
Strand+
Gene length (bp)2108
Transcript length (bp)1857
Coding sequence length (bp)1854
Protein length (aa) 618

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 8.0E-06 282 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYY1|ATG15_NEUCR Putative lipase atg15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg15 PE=3 SV=3 9 499 0.0E+00
sp|Q2H6M8|ATG15_CHAGB Putative lipase atg15 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=atg15 PE=3 SV=1 60 465 0.0E+00
sp|Q1DZE0|ATG15_COCIM Putative lipase ATG15 OS=Coccidioides immitis (strain RS) GN=ATG15 PE=3 SV=2 13 499 1.0E-179
sp|Q0V1P1|AT151_PHANO Putative lipase ATG15-1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG15-1 PE=3 SV=1 27 499 6.0E-178
sp|A6REI4|ATG15_AJECN Putative lipase ATG15 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG15 PE=3 SV=2 63 499 5.0E-173
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYY1|ATG15_NEUCR Putative lipase atg15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg15 PE=3 SV=3 9 499 0.0E+00
sp|Q2H6M8|ATG15_CHAGB Putative lipase atg15 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=atg15 PE=3 SV=1 60 465 0.0E+00
sp|Q1DZE0|ATG15_COCIM Putative lipase ATG15 OS=Coccidioides immitis (strain RS) GN=ATG15 PE=3 SV=2 13 499 1.0E-179
sp|Q0V1P1|AT151_PHANO Putative lipase ATG15-1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG15-1 PE=3 SV=1 27 499 6.0E-178
sp|A6REI4|ATG15_AJECN Putative lipase ATG15 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG15 PE=3 SV=2 63 499 5.0E-173
sp|Q5B0L1|ATG15_EMENI Putative lipase atg15 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg15 PE=3 SV=2 13 498 1.0E-171
sp|Q0CXU6|ATG15_ASPTN Putative lipase atg15 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg15 PE=3 SV=1 49 499 8.0E-171
sp|A2QGD9|ATG15_ASPNC Putative lipase atg15 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg15 PE=3 SV=1 14 499 3.0E-169
sp|A7KAM5|ATG15_PENRW Putative lipase atg15 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg15 PE=3 SV=1 8 499 2.0E-165
sp|A1C6D6|ATG15_ASPCL Putative lipase atg15 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg15 PE=3 SV=1 38 499 3.0E-165
sp|A1DH10|ATG15_NEOFI Putative lipase atg15 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg15 PE=3 SV=1 14 499 5.0E-164
sp|Q4X180|ATG15_ASPFU Putative lipase atg15 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg15 PE=3 SV=1 44 499 7.0E-163
sp|O13444|ATG15_PASFU Putative lipase ATG15 OS=Passalora fulva GN=ATG15 PE=2 SV=1 11 499 7.0E-158
sp|A5DC90|ATG15_PICGU Putative lipase ATG15 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG15 PE=3 SV=2 40 463 2.0E-109
sp|A7TG13|ATG15_VANPO Putative lipase ATG15 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG15 PE=3 SV=1 69 480 3.0E-105
sp|Q6C2N7|ATG15_YARLI Putative lipase ATG15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG15 PE=3 SV=2 66 467 3.0E-102
sp|O13934|ATG15_SCHPO Putative lipase atg15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg15 PE=3 SV=1 64 463 6.0E-102
sp|A7KAJ9|ATG15_PICAN Putative lipase ATG15 OS=Pichia angusta GN=ATG15 PE=3 SV=1 69 521 2.0E-100
sp|A6ZTP2|ATG15_YEAS7 Putative lipase ATG15 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG15 PE=3 SV=1 70 479 3.0E-99
sp|A5E567|ATG15_LODEL Putative lipase ATG15 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ATG15 PE=3 SV=1 115 463 5.0E-99
sp|Q6BLM0|ATG15_DEBHA Putative lipase ATG15 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG15 PE=3 SV=2 70 478 7.0E-99
sp|Q5A4N0|ATG15_CANAL Putative lipase ATG15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG15 PE=3 SV=1 40 463 1.0E-98
sp|P25641|ATG15_YEAST Putative lipase ATG15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG15 PE=1 SV=2 70 479 2.0E-98
sp|Q6CU02|ATG15_KLULA Putative lipase ATG15 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG15 PE=3 SV=1 114 461 2.0E-98
sp|A3LV34|ATG15_PICST Putative lipase ATG15 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG15 PE=3 SV=2 67 463 3.0E-97
sp|Q75EN3|ATG15_ASHGO Putative lipase ATG15 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG15 PE=3 SV=1 70 496 9.0E-95
sp|Q6FPI6|ATG15_CANGA Putative lipase ATG15 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG15 PE=3 SV=1 114 470 4.0E-91
sp|P0CO61|ATG15_CRYNB Putative lipase ATG15 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG15 PE=3 SV=1 157 440 5.0E-81
sp|P0CO60|ATG15_CRYNJ Putative lipase ATG15 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG15 PE=3 SV=1 157 440 1.0E-80
sp|Q4PHZ2|ATG15_USTMA Putative lipase ATG15 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG15 PE=3 SV=1 70 442 3.0E-79
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7746
MSPVLAFRSAGRVITTLLSLLATATGLVSAAQRGSTPDDLVFFSPSEQVFLPPSGFSPQPEPPAPAEHAFTLRHI
YHHGVHRYPQLHRKHDVVRDDPSRVFLAAADGYPEHDLHRLTAKSRARTIERMVDRRPSVVDPIVAQSRRNGFAA
VMDASAWVTDQVSSPDVTDKNTVLSLAYMAADAYVEDDGEPRWDDVGAPFNRSADFGWHSDGLRGHVWADDSNST
VVIGLKGTTPAVFDGDGTTSKDKINDNLFFSCCCAQQGQWTWHQVCDCATDTYTCNNTCVVDALREENMYYAAAR
ELYSNVTELYPAANIWLTGHSLGGAVTSFLGLTYGLPVVTFEAVPEALAASRLGLPVPPGANAGTPQTREHTGAS
HFGHTADPVFVGSCNGATASCSFAGYAMETACHTGRECVWDVVADKGWRVGIGTHKIRSVIQDVILEYDDVPECK
FVPECRDCGQWKMYESNGTRTATSTVPSTTMTRTRTSTCETPGWFGCLDTSTTGTQTATTTSTSWTSTSTYAWLA
RVQGRDDDDDDDDDDDDDDDDDDDGIEDDDGQYDGFDDGQYDDDDDVQDPRQSLGLLGRDVDASRRSARDHGFTA
SAARHGDGVGWRRKGREA
Coding >Ophio5|7746
ATGTCGCCCGTCCTCGCGTTCCGCTCTGCTGGCAGAGTCATCACCACTCTTCTATCCCTTCTCGCCACTGCGACA
GGCTTAGTATCCGCCGCTCAACGAGGCAGCACTCCGGACGACCTCGTCTTCTTCTCCCCGAGCGAGCAAGTCTTC
CTCCCGCCCTCGGGCTTCTCGCCGCAACCGGAGCCTCCCGCGCCGGCGGAGCACGCCTTCACACTGCGCCACATC
TACCACCACGGCGTCCATCGTTATCCTCAGCTTCATCGGAAGCACGATGTCGTTCGAGACGACCCGTCGCGCGTC
TTCCTCGCCGCCGCCGACGGATACCCTGAGCACGACCTACATCGACTGACAGCCAAGAGCCGGGCTCGGACGATC
GAGCGGATGGTCGATCGCCGGCCTTCGGTCGTTGATCCCATCGTCGCCCAATCGAGGCGCAACGGCTTTGCCGCC
GTCATGGACGCTTCCGCCTGGGTCACGGACCAGGTGTCATCTCCAGACGTGACTGACAAGAATACGGTACTGAGC
TTGGCCTACATGGCGGCCGACGCCTATGTCGAGGACGATGGCGAGCCCCGGTGGGACGACGTAGGAGCGCCCTTC
AACCGCAGCGCCGACTTTGGCTGGCATAGCGATGGTCTGCGCGGTCATGTCTGGGCCGACGACTCCAATTCGACT
GTCGTCATCGGCCTCAAGGGCACCACACCCGCCGTCTTTGATGGCGACGGCACCACGTCCAAGGACAAGATCAAC
GACAATCTGTTCTTCAGCTGCTGCTGCGCCCAGCAAGGCCAGTGGACCTGGCATCAAGTCTGCGACTGCGCCACC
GACACCTACACTTGCAACAACACGTGCGTTGTCGATGCCTTGCGCGAGGAGAACATGTATTACGCCGCCGCCCGC
GAGCTCTACTCCAACGTGACGGAGCTCTATCCGGCCGCCAACATCTGGCTGACGGGACATTCGCTCGGCGGCGCC
GTCACCTCCTTTCTCGGCCTGACATACGGCCTGCCGGTCGTCACCTTCGAGGCCGTGCCGGAGGCCCTCGCCGCA
TCCCGCCTTGGCCTTCCCGTCCCACCCGGCGCCAATGCCGGCACGCCGCAGACGCGAGAGCATACCGGCGCCTCT
CACTTCGGCCACACAGCGGACCCCGTCTTCGTTGGGTCGTGCAACGGCGCGACGGCATCGTGCTCCTTTGCCGGC
TACGCCATGGAGACGGCCTGTCACACGGGCAGGGAATGCGTGTGGGACGTGGTGGCTGACAAGGGATGGCGGGTG
GGCATTGGCACGCATAAGATCCGTTCCGTCATCCAAGACGTCATCCTCGAGTACGACGACGTGCCCGAGTGCAAG
TTTGTGCCCGAGTGTCGCGACTGCGGCCAGTGGAAGATGTACGAGAGCAACGGGACGCGGACGGCGACGAGCACC
GTTCCGTCGACGACCATGACCCGTACCCGGACGTCGACGTGTGAAACGCCCGGCTGGTTTGGCTGTCTGGACACG
TCGACGACGGGCACGCAGACGGCAACTACGACGAGCACGTCTTGGACATCGACGTCGACGTACGCCTGGTTGGCT
CGGGTGCAAGGACGAGACGACGACGATGACGACGACGACGACGACGATGACGACGACGACGACGACGACGACGGA
ATTGAAGACGACGACGGCCAGTACGACGGCTTCGACGACGGCCAGTACGACGACGACGACGACGTGCAAGACCCC
AGGCAAAGTCTGGGGCTGCTGGGACGAGACGTCGACGCCAGCCGGCGCAGTGCCAGGGACCATGGCTTCACTGCG
TCCGCCGCCCGTCACGGCGACGGCGTCGGCTGGAGACGGAAAGGAAGAGAGGCG
Transcript >Ophio5|7746
ATGTCGCCCGTCCTCGCGTTCCGCTCTGCTGGCAGAGTCATCACCACTCTTCTATCCCTTCTCGCCACTGCGACA
GGCTTAGTATCCGCCGCTCAACGAGGCAGCACTCCGGACGACCTCGTCTTCTTCTCCCCGAGCGAGCAAGTCTTC
CTCCCGCCCTCGGGCTTCTCGCCGCAACCGGAGCCTCCCGCGCCGGCGGAGCACGCCTTCACACTGCGCCACATC
TACCACCACGGCGTCCATCGTTATCCTCAGCTTCATCGGAAGCACGATGTCGTTCGAGACGACCCGTCGCGCGTC
TTCCTCGCCGCCGCCGACGGATACCCTGAGCACGACCTACATCGACTGACAGCCAAGAGCCGGGCTCGGACGATC
GAGCGGATGGTCGATCGCCGGCCTTCGGTCGTTGATCCCATCGTCGCCCAATCGAGGCGCAACGGCTTTGCCGCC
GTCATGGACGCTTCCGCCTGGGTCACGGACCAGGTGTCATCTCCAGACGTGACTGACAAGAATACGGTACTGAGC
TTGGCCTACATGGCGGCCGACGCCTATGTCGAGGACGATGGCGAGCCCCGGTGGGACGACGTAGGAGCGCCCTTC
AACCGCAGCGCCGACTTTGGCTGGCATAGCGATGGTCTGCGCGGTCATGTCTGGGCCGACGACTCCAATTCGACT
GTCGTCATCGGCCTCAAGGGCACCACACCCGCCGTCTTTGATGGCGACGGCACCACGTCCAAGGACAAGATCAAC
GACAATCTGTTCTTCAGCTGCTGCTGCGCCCAGCAAGGCCAGTGGACCTGGCATCAAGTCTGCGACTGCGCCACC
GACACCTACACTTGCAACAACACGTGCGTTGTCGATGCCTTGCGCGAGGAGAACATGTATTACGCCGCCGCCCGC
GAGCTCTACTCCAACGTGACGGAGCTCTATCCGGCCGCCAACATCTGGCTGACGGGACATTCGCTCGGCGGCGCC
GTCACCTCCTTTCTCGGCCTGACATACGGCCTGCCGGTCGTCACCTTCGAGGCCGTGCCGGAGGCCCTCGCCGCA
TCCCGCCTTGGCCTTCCCGTCCCACCCGGCGCCAATGCCGGCACGCCGCAGACGCGAGAGCATACCGGCGCCTCT
CACTTCGGCCACACAGCGGACCCCGTCTTCGTTGGGTCGTGCAACGGCGCGACGGCATCGTGCTCCTTTGCCGGC
TACGCCATGGAGACGGCCTGTCACACGGGCAGGGAATGCGTGTGGGACGTGGTGGCTGACAAGGGATGGCGGGTG
GGCATTGGCACGCATAAGATCCGTTCCGTCATCCAAGACGTCATCCTCGAGTACGACGACGTGCCCGAGTGCAAG
TTTGTGCCCGAGTGTCGCGACTGCGGCCAGTGGAAGATGTACGAGAGCAACGGGACGCGGACGGCGACGAGCACC
GTTCCGTCGACGACCATGACCCGTACCCGGACGTCGACGTGTGAAACGCCCGGCTGGTTTGGCTGTCTGGACACG
TCGACGACGGGCACGCAGACGGCAACTACGACGAGCACGTCTTGGACATCGACGTCGACGTACGCCTGGTTGGCT
CGGGTGCAAGGACGAGACGACGACGATGACGACGACGACGACGACGATGACGACGACGACGACGACGACGACGGA
ATTGAAGACGACGACGGCCAGTACGACGGCTTCGACGACGGCCAGTACGACGACGACGACGACGTGCAAGACCCC
AGGCAAAGTCTGGGGCTGCTGGGACGAGACGTCGACGCCAGCCGGCGCAGTGCCAGGGACCATGGCTTCACTGCG
TCCGCCGCCCGTCACGGCGACGGCGTCGGCTGGAGACGGAAAGGAAGAGAGGCGTAA
Gene >Ophio5|7746
ATGTCGCCCGTCCTCGCGTTCCGCTCTGCTGGCAGAGTCATCACCACTCTTCTATCCCTTCTCGCCACTGCGACA
GGCTTAGTATCCGCCGCTCAACGAGGCAGCACTCCGGACGACCTCGTCTTCTTCTCCCCGAGCGAGCAAGTCTTC
CTCCCGCCCTCGGGCTTCTCGCCGCAACCGGAGCCTCCCGCGCCGGCGGAGCACGCCTTCACACTGCGCCACATC
TACCACCACGGCGTCCATCGTTATCCTCAGCTTCATCGGAAGCACGATGTCGTTCGAGACGACCCGTCGCGCGTC
TTCCTCGCCGCCGCCGACGGATACCCTGAGCACGACCTACATCGACTGACAGCCAAGAGCCGGGCTCGGACGATC
GAGCGGATGGTCGATCGCCGGCCTTCGGTCGTTGATCCCATCGTCGCCCAATCGAGGCGCAACGGCTTTGCCGCC
GTCATGGACGCTTCCGCCTGGGTCACGGACCAGGTGTCATCTCCAGACGTGACTGACAAGAATACGGTACTGAGC
TTGGCCTACATGGCGGCCGACGCCTATGTCGAGGACGATGGCGAGCCCCGGTGGGACGACGTAGGAGCGCCCTTC
AACCGCAGCGCCGACTTTGGCTGGCATAGCGATGGTCTGCGCGGTCATGTCTGGGCCGACGACTCCAATTCGACT
GTCGTCATCGGCCTCAAGGGCACCACACCCGCCGTCTTTGATGGCGACGGCACCACGTCCAAGGACAAGATCAAC
GACAATCTGTTCTTCAGCTGCTGCTGCGCCCAGCAAGGCCAGTGGACCTGGCATCAAGTCTGCGACTGCGCCACC
GACACCTACACTTGCAACAACACGTGCGTTGTCGATGCCTTGCGCGAGGAGAACATGTATTACGCCGCCGCCCGC
GAGCTCTACTCCAACGTGACGGAGCTCTATCCGGCCGCCAACATCTGGCTGACGGGACATTCGCTCGGCGGCGCC
GTCACCTCCTTTCTCGGCCTGACATACGGCCTGCCGGTCGTCACCTTCGAGGCCGTGCCGGAGGCCCTCGCCGCA
TCCCGCCTTGGCCTTCCCGTCCCACCCGGCGCCAATGCCGGCACGCCGCAGACGCGAGAGCATACCGGCGCCTCT
CACTTCGGCCACACAGCGGACCCCGTCTTCGTTGGGTCGTGCAACGGCGCGACGGCATCGTGCTCCTTTGCCGGC
TACGCCATGGAGACGGCCTGTCACACGGGCAGGGAATGCGTGTGGGACGTGGTGGCTGACAAGGGATGGCGGGTG
GGCATTGGCACGCATAAGATCCGTTCCGTCATCCAAGACGTCATCCTCGAGTACGACGACGTGCCCGAGTGCAAG
TTTGTGCCCGAGTGTCGCGACTGCGGCCAGTGGAAGATGTACGAGAGCAACGGGACGCGGACGGCGACGAGCACC
GTTCCGTCGACGACCATGACCCGTACCCGGACGTCGACGTGTGAAACGCCCGGCTGGTTTGGCTGTCTGGACACG
TCGACGACGGGCACGCAGACGGCAACTACGACGAGCACGTCTTGGACATCGACGTCGACGTGTAAGACGCCGGGC
TGGTTCTGGTGCAAGGATAAGACGACGTCGACGTGCGAGACGCCTGGTTGGCTCGGGTGCAAGGACGAGACGACG
ACGATGACGACGACGACGACGACGATGACGACGACGACGACGACGACGACGGAATTGAAGACGACGACGGCCAGT
ACGACGGCTTCGACGACGGCCAGTACGACGACGACGACGACGTGCAAGACCCCAGGCAAAGTCTGGGGCTGCTGG
GACGAGACGTCGACGCCAGCCGGCGCAGTGCCAGGGACCATGGCTTCACTGCGTCCGCCGCCCGTCACGGCGACG
GCGTCGGCTGGAGACGTCAGGGAGACGGACTTTTCGCCGGACGAAATTTAGTCGCCGGTTGCTTTCTGATTTGCC
CCAAGCAACGAGGGGGGGGCGTTTATTGTTTAAGGAGAAATGGGGGGCGTTGGTCATCGAGGCGTTCGATTCCGG
TTGGCAGAGCGTTGCCGGTCACTGCGAGGAGAGAGAGAGAGAGAGAGAATATTCTCGCTTCAGGGAAAGGAAGAG
AGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail