Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7743
Gene name
Locationscaffold_786:5254..6086
Strand+
Gene length (bp)832
Transcript length (bp)675
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13774 Longin Regulated-SNARE-like domain 4.0E-23 57 126
PF00957 Synaptobrevin Synaptobrevin 6.0E-14 142 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 45 224 4.0E-65
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 58 224 7.0E-63
sp|Q74ZD2|SEC22_ASHGO Protein transport protein SEC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC22 PE=3 SV=2 54 224 8.0E-54
sp|P22214|SEC22_YEAST Protein transport protein SEC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC22 PE=1 SV=1 46 221 1.0E-50
sp|Q6CJA0|SEC22_KLULA Protein transport protein SEC22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC22 PE=3 SV=1 46 223 2.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 45 224 4.0E-65
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 58 224 7.0E-63
sp|Q74ZD2|SEC22_ASHGO Protein transport protein SEC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC22 PE=3 SV=2 54 224 8.0E-54
sp|P22214|SEC22_YEAST Protein transport protein SEC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC22 PE=1 SV=1 46 221 1.0E-50
sp|Q6CJA0|SEC22_KLULA Protein transport protein SEC22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC22 PE=3 SV=1 46 223 2.0E-50
sp|Q6FWT0|SEC22_CANGA Protein transport protein SEC22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC22 PE=3 SV=1 36 212 1.0E-45
sp|Q94AU2|SEC22_ARATH 25.3 kDa vesicle transport protein OS=Arabidopsis thaliana GN=SEC22 PE=2 SV=1 45 218 5.0E-41
sp|O08595|SC22B_CRIGR Vesicle-trafficking protein SEC22b OS=Cricetulus griseus GN=Sec22b PE=1 SV=3 43 224 8.0E-38
sp|Q6P7L4|SC22B_XENTR Vesicle-trafficking protein SEC22b OS=Xenopus tropicalis GN=sec22b PE=2 SV=1 43 224 3.0E-37
sp|O08547|SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus GN=Sec22b PE=1 SV=3 43 224 2.0E-36
sp|Q5RAI9|SC22B_PONAB Vesicle-trafficking protein SEC22b OS=Pongo abelii GN=SEC22B PE=2 SV=3 43 224 2.0E-36
sp|Q4KM74|SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus GN=Sec22b PE=1 SV=3 43 224 2.0E-36
sp|Q5ZJW4|SC22B_CHICK Vesicle-trafficking protein SEC22b OS=Gallus gallus GN=SEC22B PE=2 SV=1 43 224 2.0E-35
sp|Q7SXP0|S22BB_DANRE Vesicle-trafficking protein SEC22b-B OS=Danio rerio GN=sec22bb PE=2 SV=1 43 224 3.0E-35
sp|Q7ZV15|S22BA_DANRE Vesicle-trafficking protein SEC22b-A OS=Danio rerio GN=sec22ba PE=2 SV=1 43 224 4.0E-34
sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens GN=SEC22B PE=1 SV=4 43 224 2.0E-33
sp|Q96IW7|SC22A_HUMAN Vesicle-trafficking protein SEC22a OS=Homo sapiens GN=SEC22A PE=1 SV=1 63 152 6.0E-14
sp|Q4R866|SC22A_MACFA Vesicle-trafficking protein SEC22a OS=Macaca fascicularis GN=SEC22A PE=2 SV=1 63 152 1.0E-13
sp|Q8BH47|SC22A_MOUSE Vesicle-trafficking protein SEC22a OS=Mus musculus GN=Sec22a PE=2 SV=1 63 154 1.0E-12
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 66 221 4.0E-12
sp|Q642F4|SC22A_RAT Vesicle-trafficking protein SEC22a OS=Rattus norvegicus GN=Sec22a PE=2 SV=1 63 154 1.0E-11
sp|Q5ZL74|VAMP7_CHICK Vesicle-associated membrane protein 7 OS=Gallus gallus GN=VAMP7 PE=2 SV=1 47 190 3.0E-11
sp|P70280|VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus GN=Vamp7 PE=1 SV=1 47 190 2.0E-09
sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus GN=VAMP7 PE=2 SV=1 47 190 2.0E-09
sp|P51809|VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens GN=VAMP7 PE=1 SV=3 47 190 2.0E-09
sp|Q54NW7|VAM7A_DICDI Vesicle-associated membrane protein 7A OS=Dictyostelium discoideum GN=vamp7A PE=1 SV=1 63 219 3.0E-09
sp|Q5RF94|VAMP7_PONAB Vesicle-associated membrane protein 7 OS=Pongo abelii GN=VAMP7 PE=2 SV=3 64 190 3.0E-09
sp|Q9JHW5|VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus GN=Vamp7 PE=1 SV=1 47 190 5.0E-09
sp|O60073|YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ykt6 PE=3 SV=1 83 197 4.0E-08
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 47 221 6.0E-07
sp|Q8BXT9|SC22C_MOUSE Vesicle-trafficking protein SEC22c OS=Mus musculus GN=Sec22c PE=2 SV=1 1 152 6.0E-07
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 64 197 7.0E-07
sp|Q2YDJ2|SC22C_BOVIN Vesicle-trafficking protein SEC22c OS=Bos taurus GN=SEC22C PE=2 SV=1 1 152 7.0E-07
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 66 197 9.0E-07
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 58 197 9.0E-07
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 58 197 1.0E-06
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 51 197 2.0E-06
sp|Q6CSA2|YKT6_KLULA Synaptobrevin homolog YKT6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YKT6 PE=3 SV=1 64 197 3.0E-06
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 66 195 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 200 222 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7743
MTRLRHSHLVHTKSALLKTSSHDSLHANSTARRPHALRLGGRRPKRLAPAPREQTTTSIECGSGHYTIHYLIDNE
VIFLCICERSYPRKLAFTYLSDLSREFATTHPPSQTHSPALRPYAFMDFDSFIAKTRTTYADARATQNLDKLNDE
LRDVTKVMTKNIEDLLYRGDSLDRMGEISSRLRDDSKRYRRAAVRINWELLLKQYGPFAGLGLLVLLFIYLRFF
Coding >Ophio5|7743
ATGACAAGGCTTCGACACTCTCACCTCGTCCACACCAAATCCGCTCTTCTGAAGACGAGTAGCCATGATTCTCTC
CACGCAAATAGCACGGCTAGACGGCCTCATGCTCTGCGCCTCGGTGGACGAAGACCAAAGCGACTCGCCCCCGCT
CCTAGAGAGCAAACAACAACGTCGATCGAATGCGGCTCGGGCCACTACACGATCCACTACCTCATCGACAACGAA
GTCATCTTCCTCTGCATCTGCGAACGATCCTACCCGCGAAAACTAGCCTTCACCTACCTCTCGGACCTATCGCGC
GAATTCGCAACGACGCATCCGCCGTCGCAGACGCATTCTCCCGCTCTACGTCCGTACGCCTTTATGGACTTCGAT
AGCTTCATCGCCAAGACGCGAACTACCTATGCGGATGCGCGCGCGACGCAGAATCTGGATAAGTTGAATGATGAG
TTGCGTGATGTGACAAAGGTCATGACGAAGAACATCGAGGATTTGCTCTATCGTGGTGATAGCCTCGATCGCATG
GGTGAGATCAGCAGTCGGTTGCGTGATGATAGTAAGCGTTATCGTCGGGCTGCTGTTCGCATCAATTGGGAGCTG
TTGCTTAAGCAGTACGGTCCCTTTGCTGGCTTGGGTCTCCTCGTTCTTTTGTTTATCTATCTGCGCTTCTTT
Transcript >Ophio5|7743
ATGACAAGGCTTCGACACTCTCACCTCGTCCACACCAAATCCGCTCTTCTGAAGACGAGTAGCCATGATTCTCTC
CACGCAAATAGCACGGCTAGACGGCCTCATGCTCTGCGCCTCGGTGGACGAAGACCAAAGCGACTCGCCCCCGCT
CCTAGAGAGCAAACAACAACGTCGATCGAATGCGGCTCGGGCCACTACACGATCCACTACCTCATCGACAACGAA
GTCATCTTCCTCTGCATCTGCGAACGATCCTACCCGCGAAAACTAGCCTTCACCTACCTCTCGGACCTATCGCGC
GAATTCGCAACGACGCATCCGCCGTCGCAGACGCATTCTCCCGCTCTACGTCCGTACGCCTTTATGGACTTCGAT
AGCTTCATCGCCAAGACGCGAACTACCTATGCGGATGCGCGCGCGACGCAGAATCTGGATAAGTTGAATGATGAG
TTGCGTGATGTGACAAAGGTCATGACGAAGAACATCGAGGATTTGCTCTATCGTGGTGATAGCCTCGATCGCATG
GGTGAGATCAGCAGTCGGTTGCGTGATGATAGTAAGCGTTATCGTCGGGCTGCTGTTCGCATCAATTGGGAGCTG
TTGCTTAAGCAGTACGGTCCCTTTGCTGGCTTGGGTCTCCTCGTTCTTTTGTTTATCTATCTGCGCTTCTTTTGA
Gene >Ophio5|7743
ATGACAAGGCTTCGACACTCTCACCTCGTCCACACCAAATCCGCTCTTCTGAAGACGAGTAGCCGTGTGCCGGGG
GCGTTGACCGGTCTCTTCCCCTCCTCCTCGTCCGCCAAGATGATTCTCTCCACGCAAATAGCACGGCTAGACGGT
ACGCCCCCCAGCCTCTTCCCTCCCCTGGCTCTTCACACCCAAAACTAAGGCAAGCGCAGGCCTCATGCTCTGCGC
CTCGGTGGACGAAGACCAAAGCGACTCGCCCCCGCTCCTAGAGAGCAAACAACAAGTACGGCAAGTTCTGCGGCG
AGTGACACGAAACTCATCAGCACAAGCGTCGATCGAATGCGGCTCGGGCCACTACACGATCCACTACCTCATCGA
CAACGAAGTCATCTTCCTCTGCATCTGCGAACGATCCTACCCGCGAAAACTAGCCTTCACCTACCTCTCGGACCT
ATCGCGCGAATTCGCAACGACGCATCCGCCGTCGCAGACGCATTCTCCCGCTCTACGTCCGTACGCCTTTATGGA
CTTCGATAGCTTCATCGCCAAGACGCGAACTACCTATGCGGATGCGCGCGCGACGCAGAATCTGGATAAGTTGAA
TGATGAGTTGCGTGATGTGACAAAGGTCATGACGAAGAACATCGAGGATTTGCTCTATCGTGGTGATAGCCTCGA
TCGCATGGGTGAGATCAGCAGTCGGTTGCGTGATGATAGTAAGCGTTATCGTCGGGCTGCTGTTCGCATCAATTG
GGAGCTGTTGCTTAAGCAGTACGGTCCCTTTGCTGGCTTGGGTCTCCTCGTTCTTTTGTTTATCTATCTGCGCTT
CTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail