Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7735
Gene name
Locationscaffold_783:3535..5986
Strand-
Gene length (bp)2451
Transcript length (bp)2319
Coding sequence length (bp)2316
Protein length (aa) 772

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11885 DUF3405 Protein of unknown function (DUF3405) 1.7E-192 241 755

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.13 22.89 61.36
CcL In ants, during behavior modification 105.23 44.85 165.62
CcD In ants, recently dead 105.79 53.83 157.75

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.986918 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7735
MGKMLNPPGRRKLVPLPRPRVIFLLALAAATSYLILFSGHAPRVHIVPYLRDKPAPPPSPSRPDELSETKAEWHV
EIDDLRYWRDPEDPENPDDVLPGYETDGKHREPGDVGRLQHEKNLRKMWRYLYKTTANLKTSNLVYGNTLESLVF
KDNRSDALRKPLREDPRVDLIFAEDKPVRFDPYPDYNSDVWRRNGHAPYVPCKGPTGELVEDLLVFKGRPEKWPA
SKFGSYDVLEMDANLCWERETRLGPFGLVQQKKKVGGEYRPVDWDNVNWGGLQQRCLKLNSDRFDMRKSQKNEYL
SAYPETAEPVPPPAEQAVQAQLRHHKVARRSTQPAHVDKEQARRGAESVQDGALKVKEKRTAVLLRSYTGRKYSE
NDKQVIRALVSELSLKTGGEYEIFLLVHSKDRNQRIFDDQEAYMSVLRDNVPAEFRGMTVLWNDEQVGNIYTKLT
DEEERSVHTAQWLSVQKFSHDHPQFDFIWNWEMDFRYTGHHYDLLDKLGRFAKKQPRKYLWERNERWYIPEYHGD
YDTTFREQVARRHGDDTVWGPVDLPFINPVGPKPPVKSHDEDDYEWGVGEDADFITVGPMFDPIDSQWIIGKHVW
GFNDGRHKSVDLPRRTTIVTQSRISRRLLDAMHVENMRGNHVASEMTPQTIALLHGFKAVFAPHPVFMDRDWTGP
FLNSWFNPGPKGECGGRGSPMGWGRERRYQGTTWYYRAEPPNRLYNNWMGWPDTGMGGPSWEEQHGRPCLPSVML
HQVKDTEPTKADHQTGFDLAYG
Coding >Ophio5|7735
ATGGGCAAGATGCTTAATCCCCCCGGCCGGCGGAAGCTCGTGCCTCTACCGCGTCCCAGGGTCATCTTCTTACTG
GCCTTGGCCGCTGCGACGTCGTACCTGATTCTCTTTAGCGGTCACGCTCCCCGCGTTCATATCGTGCCTTACCTG
CGCGATAAGCCCGCTCCTCCACCGTCTCCATCGCGCCCCGATGAGCTGTCGGAGACAAAGGCCGAATGGCACGTC
GAGATCGATGATCTTCGGTACTGGCGCGACCCCGAAGATCCGGAGAATCCTGATGACGTCCTGCCGGGCTACGAG
ACTGATGGGAAGCACCGCGAACCTGGCGATGTCGGTCGTCTGCAGCACGAGAAGAACCTGCGCAAGATGTGGCGC
TATCTCTACAAGACGACGGCCAACCTCAAGACGTCCAACCTCGTATACGGAAACACACTCGAGTCGCTGGTCTTC
AAGGACAATCGGTCCGATGCATTGCGCAAGCCGTTGCGCGAGGACCCTCGCGTCGACCTCATCTTCGCTGAAGAC
AAGCCCGTCCGCTTCGACCCGTATCCCGACTACAACAGCGACGTCTGGAGACGTAACGGCCACGCTCCCTATGTG
CCGTGCAAGGGCCCCACTGGCGAGCTCGTCGAGGATCTGCTCGTCTTCAAAGGCCGGCCCGAGAAGTGGCCGGCC
TCCAAGTTTGGCAGCTACGACGTGCTCGAGATGGACGCCAACCTCTGCTGGGAGCGCGAGACCCGTCTCGGCCCC
TTTGGTCTGGTGCAGCAGAAGAAAAAGGTGGGCGGCGAGTACAGGCCCGTCGACTGGGATAACGTCAACTGGGGC
GGCCTGCAACAGCGCTGCTTGAAGCTCAACTCGGATCGTTTCGACATGCGCAAGAGTCAGAAGAACGAGTATCTG
TCCGCCTACCCCGAGACGGCCGAACCCGTTCCGCCGCCGGCCGAGCAGGCGGTGCAGGCGCAGCTTCGTCACCAC
AAGGTGGCACGTCGCAGTACCCAGCCGGCCCACGTGGACAAGGAACAGGCACGCCGAGGCGCCGAGTCGGTCCAG
GACGGCGCGCTCAAGGTCAAGGAGAAGAGGACGGCGGTGCTGCTCCGGTCGTACACGGGCCGCAAGTACTCGGAA
AACGACAAGCAGGTGATCCGGGCCCTCGTCAGCGAGCTCAGCCTCAAGACGGGCGGCGAGTACGAAATATTCCTG
CTGGTACACTCCAAGGACCGCAACCAGCGCATCTTCGACGATCAAGAGGCCTACATGTCGGTGCTGCGCGACAAC
GTGCCGGCCGAATTCCGCGGCATGACGGTGCTGTGGAACGACGAGCAGGTGGGCAACATCTACACCAAGTTGACG
GACGAGGAAGAGCGAAGCGTGCACACGGCGCAGTGGCTGTCGGTGCAAAAGTTCAGTCACGACCATCCGCAGTTC
GACTTTATCTGGAACTGGGAGATGGACTTTCGCTATACCGGTCACCACTACGACCTGCTTGACAAGCTGGGCCGG
TTCGCCAAGAAGCAGCCTCGCAAGTATCTGTGGGAGCGCAATGAGCGCTGGTACATTCCGGAATATCACGGCGAC
TACGACACGACCTTCCGCGAGCAGGTGGCGCGACGTCACGGTGACGACACCGTCTGGGGCCCCGTCGACCTGCCC
TTCATCAATCCCGTCGGCCCGAAGCCGCCGGTCAAGTCTCACGACGAGGACGATTACGAATGGGGCGTAGGCGAG
GATGCCGACTTCATCACCGTCGGCCCCATGTTCGACCCCATCGACAGCCAGTGGATCATCGGCAAGCACGTCTGG
GGCTTCAACGATGGCCGTCACAAGTCGGTCGACCTGCCCCGGAGGACCACGATTGTGACGCAGTCGCGCATCTCG
AGACGCCTTCTCGACGCCATGCACGTCGAGAACATGCGTGGTAACCACGTGGCGTCGGAGATGACGCCCCAGACG
ATTGCTCTGCTTCATGGCTTCAAAGCCGTCTTCGCGCCGCATCCGGTCTTTATGGATCGGGATTGGACGGGACCC
TTCCTCAACAGCTGGTTCAACCCGGGACCCAAGGGCGAGTGCGGCGGCCGAGGGAGCCCGATGGGTTGGGGCCGC
GAGCGTCGATATCAGGGCACGACGTGGTACTACCGTGCCGAGCCGCCCAACCGGCTGTACAACAACTGGATGGGC
TGGCCCGACACAGGCATGGGCGGGCCGTCCTGGGAGGAGCAGCACGGGCGGCCTTGCCTGCCGTCGGTGATGCTC
CATCAGGTCAAGGATACGGAGCCGACCAAAGCGGATCACCAGACGGGCTTTGACCTGGCCTACGGC
Transcript >Ophio5|7735
ATGGGCAAGATGCTTAATCCCCCCGGCCGGCGGAAGCTCGTGCCTCTACCGCGTCCCAGGGTCATCTTCTTACTG
GCCTTGGCCGCTGCGACGTCGTACCTGATTCTCTTTAGCGGTCACGCTCCCCGCGTTCATATCGTGCCTTACCTG
CGCGATAAGCCCGCTCCTCCACCGTCTCCATCGCGCCCCGATGAGCTGTCGGAGACAAAGGCCGAATGGCACGTC
GAGATCGATGATCTTCGGTACTGGCGCGACCCCGAAGATCCGGAGAATCCTGATGACGTCCTGCCGGGCTACGAG
ACTGATGGGAAGCACCGCGAACCTGGCGATGTCGGTCGTCTGCAGCACGAGAAGAACCTGCGCAAGATGTGGCGC
TATCTCTACAAGACGACGGCCAACCTCAAGACGTCCAACCTCGTATACGGAAACACACTCGAGTCGCTGGTCTTC
AAGGACAATCGGTCCGATGCATTGCGCAAGCCGTTGCGCGAGGACCCTCGCGTCGACCTCATCTTCGCTGAAGAC
AAGCCCGTCCGCTTCGACCCGTATCCCGACTACAACAGCGACGTCTGGAGACGTAACGGCCACGCTCCCTATGTG
CCGTGCAAGGGCCCCACTGGCGAGCTCGTCGAGGATCTGCTCGTCTTCAAAGGCCGGCCCGAGAAGTGGCCGGCC
TCCAAGTTTGGCAGCTACGACGTGCTCGAGATGGACGCCAACCTCTGCTGGGAGCGCGAGACCCGTCTCGGCCCC
TTTGGTCTGGTGCAGCAGAAGAAAAAGGTGGGCGGCGAGTACAGGCCCGTCGACTGGGATAACGTCAACTGGGGC
GGCCTGCAACAGCGCTGCTTGAAGCTCAACTCGGATCGTTTCGACATGCGCAAGAGTCAGAAGAACGAGTATCTG
TCCGCCTACCCCGAGACGGCCGAACCCGTTCCGCCGCCGGCCGAGCAGGCGGTGCAGGCGCAGCTTCGTCACCAC
AAGGTGGCACGTCGCAGTACCCAGCCGGCCCACGTGGACAAGGAACAGGCACGCCGAGGCGCCGAGTCGGTCCAG
GACGGCGCGCTCAAGGTCAAGGAGAAGAGGACGGCGGTGCTGCTCCGGTCGTACACGGGCCGCAAGTACTCGGAA
AACGACAAGCAGGTGATCCGGGCCCTCGTCAGCGAGCTCAGCCTCAAGACGGGCGGCGAGTACGAAATATTCCTG
CTGGTACACTCCAAGGACCGCAACCAGCGCATCTTCGACGATCAAGAGGCCTACATGTCGGTGCTGCGCGACAAC
GTGCCGGCCGAATTCCGCGGCATGACGGTGCTGTGGAACGACGAGCAGGTGGGCAACATCTACACCAAGTTGACG
GACGAGGAAGAGCGAAGCGTGCACACGGCGCAGTGGCTGTCGGTGCAAAAGTTCAGTCACGACCATCCGCAGTTC
GACTTTATCTGGAACTGGGAGATGGACTTTCGCTATACCGGTCACCACTACGACCTGCTTGACAAGCTGGGCCGG
TTCGCCAAGAAGCAGCCTCGCAAGTATCTGTGGGAGCGCAATGAGCGCTGGTACATTCCGGAATATCACGGCGAC
TACGACACGACCTTCCGCGAGCAGGTGGCGCGACGTCACGGTGACGACACCGTCTGGGGCCCCGTCGACCTGCCC
TTCATCAATCCCGTCGGCCCGAAGCCGCCGGTCAAGTCTCACGACGAGGACGATTACGAATGGGGCGTAGGCGAG
GATGCCGACTTCATCACCGTCGGCCCCATGTTCGACCCCATCGACAGCCAGTGGATCATCGGCAAGCACGTCTGG
GGCTTCAACGATGGCCGTCACAAGTCGGTCGACCTGCCCCGGAGGACCACGATTGTGACGCAGTCGCGCATCTCG
AGACGCCTTCTCGACGCCATGCACGTCGAGAACATGCGTGGTAACCACGTGGCGTCGGAGATGACGCCCCAGACG
ATTGCTCTGCTTCATGGCTTCAAAGCCGTCTTCGCGCCGCATCCGGTCTTTATGGATCGGGATTGGACGGGACCC
TTCCTCAACAGCTGGTTCAACCCGGGACCCAAGGGCGAGTGCGGCGGCCGAGGGAGCCCGATGGGTTGGGGCCGC
GAGCGTCGATATCAGGGCACGACGTGGTACTACCGTGCCGAGCCGCCCAACCGGCTGTACAACAACTGGATGGGC
TGGCCCGACACAGGCATGGGCGGGCCGTCCTGGGAGGAGCAGCACGGGCGGCCTTGCCTGCCGTCGGTGATGCTC
CATCAGGTCAAGGATACGGAGCCGACCAAAGCGGATCACCAGACGGGCTTTGACCTGGCCTACGGCTGA
Gene >Ophio5|7735
ATGGGCAAGATGCTTAATCCCCCCGGCCGGCGGAAGCTCGTGCCTCTACCGCGTCCCAGGGTCATCTTCTTACTG
GCCTTGGCCGCTGCGACGTCGTACCTGATTCTCTTTAGCGGTCACGCTCCCCGCGTTCATATCGTGCCTTACCTG
CGCGATAAGCCCGCTCCTCCACCGTCTCCATCGCGCCCCGATGAGCTGTCGGAGACAAAGGCCGAATGGCACGTC
GAGATCGATGATCTTCGGTACTGGCGCGACCCCGAAGATCCGGAGAATCCTGATGACGTCCTGCCGGGCTACGAG
ACTGATGGGAAGCACCGCGAACCTGGCGATGTCGGTCGTCTGCAGCACGAGAAGAACCTGCGCAAGATGTGGCGC
TATCTCTACAAGACGACGGCCAAGTAAGCTTTCACCTTGAGCCTCACTTCCCTAGCCCTTTTCTTGGCTGACCCA
CCGTATAGCCTCAAGACGTCCAACCTCGTATACGGAAACACACTCGAGTCGCTGGTCTTCAAGGACAATCGGTCC
GATGCATTGCGCAAGCCGTTGCGCGAGGACCCTCGCGTCGACCTCATCTTCGCTGAAGACAAGCCCGTCCGCTTC
GACCCGTATCCCGACTACAACAGCGACGTCTGGAGACGTAACGGCCACGCTCCCTATGTGCCGTGCAAGGGCCCC
ACTGGCGAGCTCGTCGAGGATCTGCTCGTCTTCAAAGGCCGGCCCGAGAAGTGGCCGGCCTCCAAGTTTGGCAGC
TACGACGTGCTCGAGATGGACGCCAACCTCTGCTGGGAGCGCGAGACCCGTCTCGGCCCCTTTGGTCTGGTGCAG
CAGAAGAAAAAGGTGGGCGGCGAGTACAGGCCCGTCGACTGGGATAACGTCAACTGGGGCGGCCTGCAACAGCGC
TGCTTGAAGCTCAACTCGGATCGTTTCGACATGCGCAAGAGTCAGAAGAACGAGTATCTGTCCGCCTACCCCGAG
ACGGCCGAACCCGTTCCGCCGCCGGCCGAGCAGGCGGTGCAGGCGCAGCTTCGTCACCACAAGGTCGGCCATGCC
AGCCCCATTGCTCCTCCTTCTCCTCCTTCGCCTCCGTCCTCACACGGCCGCGCGCAGCAGGTGGCACGTCGCAGT
ACCCAGCCGGCCCACGTGGACAAGGAACAGGCACGCCGAGGCGCCGAGTCGGTCCAGGACGGCGCGCTCAAGGTC
AAGGAGAAGAGGACGGCGGTGCTGCTCCGGTCGTACACGGGCCGCAAGTACTCGGAAAACGACAAGCAGGTGATC
CGGGCCCTCGTCAGCGAGCTCAGCCTCAAGACGGGCGGCGAGTACGAAATATTCCTGCTGGTACACTCCAAGGAC
CGCAACCAGCGCATCTTCGACGATCAAGAGGCCTACATGTCGGTGCTGCGCGACAACGTGCCGGCCGAATTCCGC
GGCATGACGGTGCTGTGGAACGACGAGCAGGTGGGCAACATCTACACCAAGTTGACGGACGAGGAAGAGCGAAGC
GTGCACACGGCGCAGTGGCTGTCGGTGCAAAAGTTCAGTCACGACCATCCGCAGTTCGACTTTATCTGGAACTGG
GAGATGGACTTTCGCTATACCGGTCACCACTACGACCTGCTTGACAAGCTGGGCCGGTTCGCCAAGAAGCAGCCT
CGCAAGTATCTGTGGGAGCGCAATGAGCGCTGGTACATTCCGGAATATCACGGCGACTACGACACGACCTTCCGC
GAGCAGGTGGCGCGACGTCACGGTGACGACACCGTCTGGGGCCCCGTCGACCTGCCCTTCATCAATCCCGTCGGC
CCGAAGCCGCCGGTCAAGTCTCACGACGAGGACGATTACGAATGGGGCGTAGGCGAGGATGCCGACTTCATCACC
GTCGGCCCCATGTTCGACCCCATCGACAGCCAGTGGATCATCGGCAAGCACGTCTGGGGCTTCAACGATGGCCGT
CACAAGTCGGTCGACCTGCCCCGGAGGACCACGATTGTGACGCAGTCGCGCATCTCGAGACGCCTTCTCGACGCC
ATGCACGTCGAGAACATGCGTGGTAACCACGTGGCGTCGGAGATGACGCCCCAGACGATTGCTCTGCTTCATGGC
TTCAAAGCCGTCTTCGCGCCGCATCCGGTCTTTATGGATCGGGATTGGACGGGACCCTTCCTCAACAGCTGGTTC
AACCCGGGACCCAAGGGCGAGTGCGGCGGCCGAGGGAGCCCGATGGGTTGGGGCCGCGAGCGTCGATATCAGGGC
ACGACGTGGTACTACCGTGCCGAGCCGCCCAACCGGCTGTACAACAACTGGATGGGCTGGCCCGACACAGGCATG
GGCGGGCCGTCCTGGGAGGAGCAGCACGGGCGGCCTTGCCTGCCGTCGGTGATGCTCCATCAGGTCAAGGATACG
GAGCCGACCAAAGCGGATCACCAGACGGGCTTTGACCTGGCCTACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail