Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7725
Gene name
Locationscaffold_78:46179..49115
Strand+
Gene length (bp)2936
Transcript length (bp)2631
Coding sequence length (bp)2628
Protein length (aa) 876

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.5E-23 306 550
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.3E-10 64 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 55 823 5.0E-44
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 57 593 2.0E-29
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 291 718 9.0E-26
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 65 672 5.0E-24
sp|Q9C0Z1|YKM1_SCHPO Uncharacterized transcriptional regulatory protein PB24D3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.01 PE=3 SV=2 284 667 9.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 55 823 5.0E-44
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 57 593 2.0E-29
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 291 718 9.0E-26
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 65 672 5.0E-24
sp|Q9C0Z1|YKM1_SCHPO Uncharacterized transcriptional regulatory protein PB24D3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.01 PE=3 SV=2 284 667 9.0E-20
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 58 468 4.0E-18
sp|P49413|UAY_EMENI Positive regulator of purine utilization OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uaY PE=3 SV=2 61 482 2.0E-16
sp|P04386|GAL4_YEAST Regulatory protein GAL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL4 PE=1 SV=2 62 468 7.0E-16
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 290 660 2.0E-15
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 295 554 2.0E-15
sp|O94573|YGDG_SCHPO Uncharacterized transcriptional regulatory protein C1773.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.16c PE=3 SV=1 290 665 6.0E-14
sp|O94569|YGDC_SCHPO Uncharacterized transcriptional regulatory protein C1773.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.12 PE=3 SV=1 292 691 2.0E-13
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 338 662 2.0E-11
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 290 594 2.0E-11
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 252 670 4.0E-11
sp|P38699|STB5_YEAST Protein STB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB5 PE=1 SV=1 309 548 4.0E-10
sp|P52959|CTF1B_FUSSO Cutinase transcription factor 1 beta OS=Fusarium solani subsp. pisi GN=CTF1-BETA PE=2 SV=1 296 590 4.0E-10
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 51 132 1.0E-09
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 296 855 4.0E-09
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 60 611 6.0E-09
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 54 115 7.0E-09
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 57 101 8.0E-09
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 54 97 9.0E-09
sp|P38114|TBS1_YEAST Uncharacterized transcriptional regulatory protein TBS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TBS1 PE=1 SV=1 18 704 2.0E-08
sp|P39113|CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT8 PE=1 SV=2 61 122 2.0E-08
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 54 526 5.0E-08
sp|P11638|QA1F_NEUCR Quinic acid utilization activator OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-1f PE=3 SV=2 57 121 7.0E-08
sp|Q6FLP2|RGT1_CANGA Glucose transport transcription regulator RGT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RGT1 PE=3 SV=1 51 108 1.0E-07
sp|P15699|AMDR_EMENI Acetamidase regulatory protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=amdR PE=3 SV=2 65 690 1.0E-07
sp|O93870|FCR1_CANAX Fluconazole resistance protein 1 OS=Candida albicans GN=FCR1 PE=3 SV=1 58 128 3.0E-07
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 296 855 3.0E-07
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 54 102 3.0E-07
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 59 107 5.0E-07
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 371 554 8.0E-07
sp|Q05958|ECM22_YEAST Sterol regulatory element-binding protein ECM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM22 PE=1 SV=1 54 120 1.0E-06
sp|C5E4G1|RGT1_ZYGRC Glucose transport transcription regulator RGT1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RGT1 PE=3 SV=1 53 108 1.0E-06
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 66 126 2.0E-06
sp|Q1MTM9|YFN1_SCHPO Uncharacterized transcriptional regulatory protein C1327.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1327.01c PE=1 SV=2 50 103 2.0E-06
sp|P07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPR1 PE=1 SV=1 65 326 5.0E-06
sp|P08657|LAC9_KLULA Lactose regulatory protein LAC9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC9 PE=1 SV=1 298 549 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0046872 metal ion binding No
GO:0046483 heterocycle metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0140110 transcription regulator activity No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0016070 RNA metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009889 regulation of biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7725
MDHMAFQIPGMAPPPVMNQPPQIFGPYGPEGMPHMAPDFASHMFPDAHLLMEDTNEAKRRRIARACDMCRKKKIK
CDGKLPACTHCINYKTDCVFTQVEKKRSPPKGAKYIEGLENRLGRMEHLLKLSGLLSQDDNGATDLGELEKKLTE
KTRQASLAAVSSPTSPSQGTSGQDGNSSTPHSALTSPEPGKETHRIDDKPKSSMSTEESAGEGEVEALSEMMCSL
VTNQSGETRYIGSSSGFSIFSPRGIQWVNEKTGDESFSQMISEVSVDDHKWTNWKPEVFGDLFQRRVFRPLPSKP
ETLSLLKDYFENFNCMFPLFHQPTFMHLVERQYSPDPYQGSGWWASLNCVLAIAHRLRVMSNLVPQEEDEKAWAY
LKNAMAVFPELTMRNTDLLSVQALLGMALFMQGTPNPQPTSLLVAAAIRLAHNIGLHKRGTGFNLNPIEIEQRKR
VFWIAYMLDKDLCLRSGRPAAQDDDDMNVDLPDADPIDNIGNIPLAEGKGKMNLFRVICEFTVIESNVYKRLYST
LATKQSDGELLNTIGELDQELEEWKDKIPIDFRPEHEIKASHTPLILHVVMLHFTYYNCLTTIHRMSIHHGYWTS
RLSNYAIQGLNARPLNPRVFSSAALCTAAARASISLLKYIPQGDFSCVWLILYFPVSALMTLFGNILQNPLDPRA
KSDTRLMNLVVNFLSMLGQEAEQGGVHRMLGVCSEFVRIAKVVIDKAEREQSARRKRKNNEAVARPAGQSGAMST
PRPGTANTATPTPTGAHSAAASHLSPSAPSEYGLTPGAANEPSPSAESVGWPREFQPPQNGDLDSYQNVAMTSPP
MLRGGPFQQPLLPQDLFGLPASLDWNWAEMSGGAYPTVENGNFGDDPSSMQ
Coding >Ophio5|7725
ATGGATCACATGGCCTTCCAGATCCCCGGCATGGCGCCGCCACCCGTCATGAACCAGCCGCCTCAGATCTTCGGC
CCCTACGGCCCCGAGGGTATGCCGCACATGGCACCCGATTTTGCGTCGCACATGTTCCCCGACGCACATCTGTTA
ATGGAGGACACCAATGAAGCCAAGCGCCGGAGAATCGCGAGGGCCTGCGATATGTGCCGCAAGAAGAAGATCAAG
TGTGATGGGAAGCTACCGGCTTGTACGCACTGCATCAACTACAAAACCGATTGTGTCTTCACCCAGGTCGAGAAG
AAGCGCAGCCCTCCCAAGGGCGCGAAATACATTGAGGGACTGGAGAATAGGCTGGGTCGTATGGAGCATCTGTTG
AAGCTGTCTGGCCTGCTCAGCCAGGACGACAATGGCGCCACCGACCTCGGCGAACTGGAAAAGAAACTAACGGAA
AAGACGCGACAGGCGTCTTTGGCCGCCGTCTCCAGCCCAACCTCTCCTTCGCAGGGCACTTCCGGCCAGGACGGC
AATAGCTCGACGCCTCACAGCGCCCTGACGTCGCCCGAGCCCGGCAAGGAAACGCACCGCATCGACGACAAGCCC
AAGTCGTCCATGTCGACCGAGGAGAGCGCGGGAGAGGGCGAGGTCGAGGCCCTGTCCGAGATGATGTGCTCTCTC
GTCACCAATCAAAGCGGCGAGACGCGCTATATCGGCTCATCCTCGGGCTTCTCCATCTTCTCGCCCAGGGGCATC
CAATGGGTCAACGAGAAGACGGGCGATGAGTCCTTCTCCCAGATGATCTCCGAGGTGTCCGTCGACGACCACAAG
TGGACCAACTGGAAGCCCGAGGTCTTCGGCGACCTATTCCAGCGCCGCGTCTTCCGCCCGCTGCCATCCAAGCCC
GAGACACTGTCGCTGCTCAAGGACTACTTTGAAAACTTCAACTGCATGTTCCCCCTCTTCCACCAGCCGACCTTT
ATGCACCTCGTCGAACGGCAATATTCGCCGGACCCCTATCAGGGCTCTGGCTGGTGGGCCAGCCTCAACTGCGTC
TTGGCCATCGCCCATCGCCTGCGAGTCATGAGCAACCTGGTACCGCAGGAGGAGGACGAAAAGGCCTGGGCTTAT
CTGAAGAACGCCATGGCCGTCTTCCCGGAGCTGACGATGCGAAACACGGACCTGTTGAGCGTCCAAGCGCTTCTC
GGCATGGCCCTCTTCATGCAAGGCACTCCCAATCCGCAGCCGACGTCGCTCCTGGTGGCCGCCGCCATCCGCCTG
GCACACAACATCGGCCTCCACAAGCGAGGCACCGGCTTCAACCTCAACCCGATCGAGATTGAGCAGCGCAAGCGC
GTCTTCTGGATCGCCTACATGCTGGACAAGGACCTCTGTCTCCGCTCCGGCCGCCCGGCCGCCCAGGACGATGAC
GACATGAATGTCGATCTGCCGGATGCCGACCCCATCGACAACATCGGTAACATCCCGCTTGCCGAAGGCAAGGGC
AAGATGAACCTGTTCCGCGTCATCTGCGAGTTCACCGTGATCGAGAGCAACGTTTACAAGCGCCTCTATTCGACG
CTCGCCACCAAGCAGTCTGACGGCGAGCTGCTCAACACCATCGGCGAGCTCGACCAGGAGCTCGAGGAGTGGAAG
GACAAGATTCCCATCGACTTCCGGCCCGAGCACGAGATCAAGGCGTCGCACACGCCGCTGATCCTGCACGTCGTC
ATGCTACATTTTACATACTACAACTGCCTGACGACGATCCACCGCATGTCGATCCACCACGGCTACTGGACGAGC
CGCTTGTCCAACTACGCGATTCAGGGGCTCAACGCCCGGCCTCTCAACCCCAGGGTCTTTTCCTCGGCCGCTCTG
TGCACTGCGGCAGCCAGAGCGTCCATCTCGCTCCTCAAGTACATACCTCAGGGAGACTTTAGCTGCGTCTGGCTG
ATCCTGTACTTTCCCGTGTCGGCGCTGATGACGCTGTTTGGCAACATCCTGCAAAACCCGCTCGATCCGCGGGCC
AAGTCGGACACGCGGCTGATGAACCTCGTCGTCAACTTCCTCTCCATGTTGGGCCAGGAGGCGGAGCAGGGGGGC
GTACATCGCATGCTGGGCGTGTGCTCCGAGTTCGTCCGCATCGCAAAGGTGGTCATCGACAAGGCCGAGAGGGAG
CAGTCGGCGCGTCGCAAGCGCAAGAACAACGAAGCGGTGGCTCGACCGGCCGGCCAGTCGGGGGCCATGTCGACG
CCACGGCCCGGAACGGCGAACACGGCGACGCCGACGCCGACGGGCGCCCACAGCGCGGCGGCTTCGCACCTGTCG
CCGTCGGCGCCGTCCGAGTACGGCCTCACGCCGGGAGCGGCCAACGAGCCGTCGCCGTCGGCCGAGTCGGTCGGC
TGGCCGCGCGAGTTCCAGCCACCGCAGAACGGCGACTTGGACTCGTATCAGAACGTGGCCATGACGTCTCCGCCC
ATGCTCAGGGGCGGACCCTTCCAGCAGCCGTTGCTTCCGCAGGACCTGTTTGGTCTGCCAGCGTCGCTGGACTGG
AATTGGGCCGAGATGAGCGGCGGCGCGTACCCGACGGTTGAGAATGGCAACTTTGGAGATGACCCATCGAGCATG
CAG
Transcript >Ophio5|7725
ATGGATCACATGGCCTTCCAGATCCCCGGCATGGCGCCGCCACCCGTCATGAACCAGCCGCCTCAGATCTTCGGC
CCCTACGGCCCCGAGGGTATGCCGCACATGGCACCCGATTTTGCGTCGCACATGTTCCCCGACGCACATCTGTTA
ATGGAGGACACCAATGAAGCCAAGCGCCGGAGAATCGCGAGGGCCTGCGATATGTGCCGCAAGAAGAAGATCAAG
TGTGATGGGAAGCTACCGGCTTGTACGCACTGCATCAACTACAAAACCGATTGTGTCTTCACCCAGGTCGAGAAG
AAGCGCAGCCCTCCCAAGGGCGCGAAATACATTGAGGGACTGGAGAATAGGCTGGGTCGTATGGAGCATCTGTTG
AAGCTGTCTGGCCTGCTCAGCCAGGACGACAATGGCGCCACCGACCTCGGCGAACTGGAAAAGAAACTAACGGAA
AAGACGCGACAGGCGTCTTTGGCCGCCGTCTCCAGCCCAACCTCTCCTTCGCAGGGCACTTCCGGCCAGGACGGC
AATAGCTCGACGCCTCACAGCGCCCTGACGTCGCCCGAGCCCGGCAAGGAAACGCACCGCATCGACGACAAGCCC
AAGTCGTCCATGTCGACCGAGGAGAGCGCGGGAGAGGGCGAGGTCGAGGCCCTGTCCGAGATGATGTGCTCTCTC
GTCACCAATCAAAGCGGCGAGACGCGCTATATCGGCTCATCCTCGGGCTTCTCCATCTTCTCGCCCAGGGGCATC
CAATGGGTCAACGAGAAGACGGGCGATGAGTCCTTCTCCCAGATGATCTCCGAGGTGTCCGTCGACGACCACAAG
TGGACCAACTGGAAGCCCGAGGTCTTCGGCGACCTATTCCAGCGCCGCGTCTTCCGCCCGCTGCCATCCAAGCCC
GAGACACTGTCGCTGCTCAAGGACTACTTTGAAAACTTCAACTGCATGTTCCCCCTCTTCCACCAGCCGACCTTT
ATGCACCTCGTCGAACGGCAATATTCGCCGGACCCCTATCAGGGCTCTGGCTGGTGGGCCAGCCTCAACTGCGTC
TTGGCCATCGCCCATCGCCTGCGAGTCATGAGCAACCTGGTACCGCAGGAGGAGGACGAAAAGGCCTGGGCTTAT
CTGAAGAACGCCATGGCCGTCTTCCCGGAGCTGACGATGCGAAACACGGACCTGTTGAGCGTCCAAGCGCTTCTC
GGCATGGCCCTCTTCATGCAAGGCACTCCCAATCCGCAGCCGACGTCGCTCCTGGTGGCCGCCGCCATCCGCCTG
GCACACAACATCGGCCTCCACAAGCGAGGCACCGGCTTCAACCTCAACCCGATCGAGATTGAGCAGCGCAAGCGC
GTCTTCTGGATCGCCTACATGCTGGACAAGGACCTCTGTCTCCGCTCCGGCCGCCCGGCCGCCCAGGACGATGAC
GACATGAATGTCGATCTGCCGGATGCCGACCCCATCGACAACATCGGTAACATCCCGCTTGCCGAAGGCAAGGGC
AAGATGAACCTGTTCCGCGTCATCTGCGAGTTCACCGTGATCGAGAGCAACGTTTACAAGCGCCTCTATTCGACG
CTCGCCACCAAGCAGTCTGACGGCGAGCTGCTCAACACCATCGGCGAGCTCGACCAGGAGCTCGAGGAGTGGAAG
GACAAGATTCCCATCGACTTCCGGCCCGAGCACGAGATCAAGGCGTCGCACACGCCGCTGATCCTGCACGTCGTC
ATGCTACATTTTACATACTACAACTGCCTGACGACGATCCACCGCATGTCGATCCACCACGGCTACTGGACGAGC
CGCTTGTCCAACTACGCGATTCAGGGGCTCAACGCCCGGCCTCTCAACCCCAGGGTCTTTTCCTCGGCCGCTCTG
TGCACTGCGGCAGCCAGAGCGTCCATCTCGCTCCTCAAGTACATACCTCAGGGAGACTTTAGCTGCGTCTGGCTG
ATCCTGTACTTTCCCGTGTCGGCGCTGATGACGCTGTTTGGCAACATCCTGCAAAACCCGCTCGATCCGCGGGCC
AAGTCGGACACGCGGCTGATGAACCTCGTCGTCAACTTCCTCTCCATGTTGGGCCAGGAGGCGGAGCAGGGGGGC
GTACATCGCATGCTGGGCGTGTGCTCCGAGTTCGTCCGCATCGCAAAGGTGGTCATCGACAAGGCCGAGAGGGAG
CAGTCGGCGCGTCGCAAGCGCAAGAACAACGAAGCGGTGGCTCGACCGGCCGGCCAGTCGGGGGCCATGTCGACG
CCACGGCCCGGAACGGCGAACACGGCGACGCCGACGCCGACGGGCGCCCACAGCGCGGCGGCTTCGCACCTGTCG
CCGTCGGCGCCGTCCGAGTACGGCCTCACGCCGGGAGCGGCCAACGAGCCGTCGCCGTCGGCCGAGTCGGTCGGC
TGGCCGCGCGAGTTCCAGCCACCGCAGAACGGCGACTTGGACTCGTATCAGAACGTGGCCATGACGTCTCCGCCC
ATGCTCAGGGGCGGACCCTTCCAGCAGCCGTTGCTTCCGCAGGACCTGTTTGGTCTGCCAGCGTCGCTGGACTGG
AATTGGGCCGAGATGAGCGGCGGCGCGTACCCGACGGTTGAGAATGGCAACTTTGGAGATGACCCATCGAGCATG
CAGTGA
Gene >Ophio5|7725
ATGGATCACATGGCCTTCCAGATCCCCGGCATGGCGCCGCCACCCGTCATGAACCAGCCGCCTCAGATCTTCGGC
CCCTACGGCCCCGAGGGTATGCCGCACATGGCACCCGATTTTGCGTCGCACATGTTCCCCGACGCACATCTGTTA
ATGGAGGACACCAATGAAGCCAAGCGCCGGAGAATCGCGAGGGTAAAGTCTTTCCGCGCCCTCGCCCGCACCGCC
GCGCCGCTGACTTCGTTCAGGCCTGCGATATGTGCCGCAAGAAGAAGATCAAGTGTGATGGGAAGCTACCGGCTT
GTACGCACTGCATCAACTACAAAACCGATTGTGTCTTCACCCAGGTCGAGAAGAAGCGCAGCCCTCCCAAGGGGT
ATGTATTCATGACTCCCTTCACCGCCTTGTGAGACAGCGAAGCTGATGCGCCGTCCAGCGCGAAATACATTGAGG
GACTGGAGAATAGGCTGGGTCGTATGGAGCATCTGTTGAAGCTGTCTGGTGAGTATGCTCCGTGCTCGGCGCCTT
CCTTGTCCCGAGAGGCATCCGCTTACCCTTCCCGTCCAGGCCTGCTCAGCCAGGACGACAATGGCGCCACCGACC
TCGGCGAACTGGAAAAGAAACTAACGGAAAAGACGCGACAGGCGTCTTTGGCCGCCGTCTCCAGCCCAACCTCTC
CTTCGCAGGGCACTTCCGGCCAGGACGGCAATAGCTCGACGCCTCACAGCGCCCTGACGTCGCCCGAGCCCGGCA
AGGAAACGCACCGCATCGACGACAAGCCCAAGTCGTCCATGTCGACCGAGGAGAGCGCGGGAGAGGGCGAGGTCG
AGGCCCTGTCCGAGATGATGTGCTCTCTCGTCACCAATCAAAGCGGCGAGACGCGCTATATCGGTAATCAATCTC
TTTCCCTGCTCGCCTTGGGGTCGCCCCTTTCTGATTTTTGAATGTTGTTCGCCAGGCTCATCCTCGGGCTTCTCC
ATCTTCTCGCCCAGGGGCATCCAATGGGTCAACGAGAAGACGGGCGATGAGTCCTTCTCCCAGATGATCTCCGAG
GTGTCCGTCGACGACCACAAGTGGACCAACTGGAAGCCCGAGGTCTTCGGCGACCTATTCCAGCGCCGCGTCTTC
CGCCCGCTGCCATCCAAGCCCGAGACACTGTCGCTGCTCAAGGACTACTTTGAAAACTTCAACTGCATGTTCCCC
CTCTTCCACCAGCCGACCTTTATGCACCTCGTCGAACGGCAATATTCGCCGGACCCCTATCAGGGCTCTGGCTGG
TGGGCCAGCCTCAACTGCGTCTTGGCCATCGCCCATCGCCTGCGAGTCATGAGCAACCTGGTACCGCAGGAGGAG
GACGAAAAGGCCTGGGCTTATCTGAAGAACGCCATGGCCGTCTTCCCGGAGCTGACGATGCGAAACACGGACCTG
TTGAGCGTCCAAGCGCTTCTCGGCATGGCCCTCTTCATGCAAGGCACTCCCAATCCGCAGCCGACGTCGCTCCTG
GTGGCCGCCGCCATCCGCCTGGCACACAACATCGGCCTCCACAAGCGAGGCACCGGCTTCAACCTCAACCCGATC
GAGATTGAGCAGCGCAAGCGCGTCTTCTGGATCGCCTACATGCTGGACAAGGACCTCTGTCTCCGCTCCGGCCGC
CCGGCCGCCCAGGACGATGACGACATGAATGTCGATCTGCCGGATGCCGACCCCATCGACAACATCGGTAACATC
CCGCTTGCCGAAGGCAAGGGCAAGATGAACCTGTTCCGCGTCATCTGCGAGTTCACCGTGATCGAGAGCAACGTT
TACAAGCGCCTCTATTCGACGCTCGCCACCAAGCAGTCTGACGGCGAGCTGCTCAACACCATCGGCGAGCTCGAC
CAGGAGCTCGAGGAGTGGAAGGACAAGATTCCCATCGACTTCCGGCCCGAGCACGAGATCAAGGCGTCGCACACG
CCGCTGATCCTGCACGTCGTCATGCTACATTTTACATACTACAACTGCCTGACGACGATCCACCGCATGTCGATC
CACCACGGCTACTGGACGAGCCGCTTGTCCAACTACGCGATTCAGGGGCTCAACGCCCGGCCTCTCAACCCCAGG
GTCTTTTCCTCGGCCGCTCTGTGCACTGCGGCAGCCAGAGCGTCCATCTCGCTCCTCAAGTACATACCTCAGGGA
GACTTTAGCTGCGTCTGGTGAGTCTCCGCCTTCGGCCGTCTTGTTGCGTCTAACCGTGCTGACGGGCCCTCCGCA
GGCTGATCCTGTACTTTCCCGTGTCGGCGCTGATGACGCTGTTTGGCAACATCCTGCAAAACCCGCTCGATCCGC
GGGCCAAGTCGGACACGCGGCTGATGAACCTCGTCGTCAACTTCCTCTCCATGTTGGGCCAGGAGGCGGAGCAGG
GGGGCGTACATCGCATGCTGGGCGTGTGCTCCGAGTTCGTCCGCATCGCAAAGGTGGTCATCGACAAGGCCGAGA
GGGAGCAGTCGGCGCGTCGCAAGCGCAAGAACAACGAAGCGGTGGCTCGACCGGCCGGCCAGTCGGGGGCCATGT
CGACGCCACGGCCCGGAACGGCGAACACGGCGACGCCGACGCCGACGGGCGCCCACAGCGCGGCGGCTTCGCACC
TGTCGCCGTCGGCGCCGTCCGAGTACGGCCTCACGCCGGGAGCGGCCAACGAGCCGTCGCCGTCGGCCGAGTCGG
TCGGCTGGCCGCGCGAGTTCCAGCCACCGCAGAACGGCGACTTGGACTCGTATCAGAACGTGGCCATGACGTCTC
CGCCCATGCTCAGGGGCGGACCCTTCCAGCAGCCGTTGCTTCCGCAGGACCTGTTTGGTCTGCCAGCGTCGCTGG
ACTGGAATTGGGCCGAGATGAGCGGCGGCGCGTACCCGACGGTTGAGAATGGCAACTTTGGAGATGACCCATCGA
GCATGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail