Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7724
Gene name
Locationscaffold_78:42537..44226
Strand+
Gene length (bp)1689
Transcript length (bp)1629
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 357 379 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 354.06 155.74 552.39
CcL In ants, during behavior modification 242.59 105.62 379.55
CcD In ants, recently dead 261.05 122.86 399.25

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.186732 no
SC16a CcD 0.284084 no
CcL CcD 0.820642 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7724
MDGQQPSSLPRAAKSPHFLHRHYHDNSRRRDATHDNSHHHSSRHGTPHLTATCSDDATESLDELASDCDSSHARL
QLRTVTEPSGSEQAPVADAAAYSNVAITGVSSQAATVSSASDTVASSASDTVVSSALDTVASSGLDTATSNVNTA
PSASTNTVTAATSSYTSASFAAPTSLLADIKTTSWLTTAPASTPSPITSTHAIFSDLRNGTNAMPNANSSLATSP
LTVSSSPSNSSLPSSLNSSSPTTSSFDVSILSAPTSFTRTSTESQVTSLVREVVTKTDLESESTESADAQSTSFV
TEFFDDSSSSLPATASTSSGGGAVAPETTGSIPPNKGSGTRSNAAAPPEALPPKARVIVGVVTSVAGVAFIMLLA
LLALKYNKKRRDGRQLLGGGHLGSMTPRGITGSDSMTTVEVPGLPTTPAPPTGFGGSRGDAPAERGFYRVAGRKL
PPVLMTGGDGFSDPRDTMLSDNSSEALDPAAGGSRPLALGAPMRPVSGIPIMRSGPARTPVTQNPFADPPSSPLA
QGGPPGSRDRSRFHEGI
Coding >Ophio5|7724
ATGGACGGCCAGCAGCCGTCGTCACTCCCTCGGGCTGCTAAATCACCGCACTTTCTGCACCGTCATTATCATGAC
AATTCCCGCCGTCGCGACGCTACTCACGACAACTCGCATCACCATTCTTCTCGTCATGGAACGCCGCACCTGACG
GCCACTTGCTCCGACGACGCCACGGAAAGCCTTGACGAGCTCGCCTCTGACTGCGATTCCTCACATGCGCGACTC
CAGCTTCGCACCGTCACCGAACCCTCTGGCTCTGAGCAAGCCCCTGTCGCAGACGCAGCCGCCTACAGCAACGTC
GCCATTACCGGCGTGAGCTCGCAGGCGGCTACCGTCAGCTCTGCGTCAGACACCGTCGCCAGCTCGGCCTCGGAC
ACGGTCGTCAGCTCTGCCTTGGACACTGTCGCCAGCTCTGGTCTGGACACGGCCACTAGCAACGTCAATACCGCC
CCCTCGGCCAGTACTAATACCGTCACGGCCGCCACGTCCTCTTACACCAGCGCCTCTTTCGCAGCTCCAACTAGC
CTTCTGGCAGACATCAAGACGACGTCGTGGCTCACAACTGCCCCGGCGTCCACTCCTTCACCCATCACCTCCACA
CATGCCATCTTCAGCGATCTACGTAATGGAACTAATGCTATGCCTAATGCAAACTCGTCGCTCGCTACCTCTCCT
CTCACCGTCTCTTCGTCTCCCTCCAACTCGTCGCTGCCGTCGTCTCTGAACTCTTCGTCACCCACCACCTCCTCT
TTTGATGTGTCCATACTGTCGGCACCGACGTCTTTCACCCGGACGTCTACCGAGTCGCAGGTTACTTCGTTGGTA
CGCGAAGTCGTGACGAAAACGGACCTTGAAAGCGAGTCGACGGAGTCTGCAGACGCACAGAGCACCTCTTTTGTC
ACCGAATTCTTCGACGACTCATCGTCTTCTCTTCCGGCGACAGCTAGTACGAGCTCAGGTGGAGGCGCCGTCGCT
CCTGAAACTACCGGGAGCATTCCACCAAACAAAGGCTCGGGAACCAGGTCCAACGCTGCGGCGCCCCCGGAAGCG
CTGCCCCCAAAGGCGCGCGTCATTGTCGGCGTCGTTACCAGCGTCGCTGGCGTCGCATTCATCATGCTTCTCGCG
CTTCTGGCTCTCAAATACAACAAGAAGCGCAGGGATGGCCGCCAGTTACTCGGAGGTGGTCACCTGGGCTCGATG
ACACCCAGGGGTATTACGGGCAGCGACTCGATGACGACGGTCGAAGTGCCGGGCCTGCCGACGACCCCCGCCCCC
CCCACCGGATTTGGGGGCAGCAGGGGTGACGCGCCAGCGGAGCGGGGCTTCTACCGAGTGGCTGGTCGGAAGCTA
CCGCCGGTCCTGATGACGGGCGGTGACGGCTTCTCGGACCCCCGGGATACCATGCTGAGCGACAACTCCTCCGAG
GCTCTGGACCCGGCGGCAGGCGGCTCACGTCCGTTGGCCCTCGGTGCGCCAATGAGGCCCGTCAGTGGGATTCCT
ATTATGCGCTCTGGACCGGCCCGTACGCCCGTCACGCAGAATCCATTTGCCGATCCCCCATCTTCGCCGTTAGCG
CAGGGTGGCCCGCCGGGATCGCGGGATCGATCCAGGTTTCACGAAGGGATA
Transcript >Ophio5|7724
ATGGACGGCCAGCAGCCGTCGTCACTCCCTCGGGCTGCTAAATCACCGCACTTTCTGCACCGTCATTATCATGAC
AATTCCCGCCGTCGCGACGCTACTCACGACAACTCGCATCACCATTCTTCTCGTCATGGAACGCCGCACCTGACG
GCCACTTGCTCCGACGACGCCACGGAAAGCCTTGACGAGCTCGCCTCTGACTGCGATTCCTCACATGCGCGACTC
CAGCTTCGCACCGTCACCGAACCCTCTGGCTCTGAGCAAGCCCCTGTCGCAGACGCAGCCGCCTACAGCAACGTC
GCCATTACCGGCGTGAGCTCGCAGGCGGCTACCGTCAGCTCTGCGTCAGACACCGTCGCCAGCTCGGCCTCGGAC
ACGGTCGTCAGCTCTGCCTTGGACACTGTCGCCAGCTCTGGTCTGGACACGGCCACTAGCAACGTCAATACCGCC
CCCTCGGCCAGTACTAATACCGTCACGGCCGCCACGTCCTCTTACACCAGCGCCTCTTTCGCAGCTCCAACTAGC
CTTCTGGCAGACATCAAGACGACGTCGTGGCTCACAACTGCCCCGGCGTCCACTCCTTCACCCATCACCTCCACA
CATGCCATCTTCAGCGATCTACGTAATGGAACTAATGCTATGCCTAATGCAAACTCGTCGCTCGCTACCTCTCCT
CTCACCGTCTCTTCGTCTCCCTCCAACTCGTCGCTGCCGTCGTCTCTGAACTCTTCGTCACCCACCACCTCCTCT
TTTGATGTGTCCATACTGTCGGCACCGACGTCTTTCACCCGGACGTCTACCGAGTCGCAGGTTACTTCGTTGGTA
CGCGAAGTCGTGACGAAAACGGACCTTGAAAGCGAGTCGACGGAGTCTGCAGACGCACAGAGCACCTCTTTTGTC
ACCGAATTCTTCGACGACTCATCGTCTTCTCTTCCGGCGACAGCTAGTACGAGCTCAGGTGGAGGCGCCGTCGCT
CCTGAAACTACCGGGAGCATTCCACCAAACAAAGGCTCGGGAACCAGGTCCAACGCTGCGGCGCCCCCGGAAGCG
CTGCCCCCAAAGGCGCGCGTCATTGTCGGCGTCGTTACCAGCGTCGCTGGCGTCGCATTCATCATGCTTCTCGCG
CTTCTGGCTCTCAAATACAACAAGAAGCGCAGGGATGGCCGCCAGTTACTCGGAGGTGGTCACCTGGGCTCGATG
ACACCCAGGGGTATTACGGGCAGCGACTCGATGACGACGGTCGAAGTGCCGGGCCTGCCGACGACCCCCGCCCCC
CCCACCGGATTTGGGGGCAGCAGGGGTGACGCGCCAGCGGAGCGGGGCTTCTACCGAGTGGCTGGTCGGAAGCTA
CCGCCGGTCCTGATGACGGGCGGTGACGGCTTCTCGGACCCCCGGGATACCATGCTGAGCGACAACTCCTCCGAG
GCTCTGGACCCGGCGGCAGGCGGCTCACGTCCGTTGGCCCTCGGTGCGCCAATGAGGCCCGTCAGTGGGATTCCT
ATTATGCGCTCTGGACCGGCCCGTACGCCCGTCACGCAGAATCCATTTGCCGATCCCCCATCTTCGCCGTTAGCG
CAGGGTGGCCCGCCGGGATCGCGGGATCGATCCAGGTTTCACGAAGGGATATGA
Gene >Ophio5|7724
ATGGACGGCCAGCAGCCGTCGTCACTCCCTCGGGCTGCTAAATCACCGCACTTTCTGCACCGTCATTATCATGAC
AATTCCCGCCGTCGCGACGCTACTCACGACAACTCGCATCACCATTCTTCTCGTCATGGAACGCCGCACCTGACG
GCCACTTGCTCCGACGACGCCACGGAAAGCCTTGACGAGCTCGCCTCTGACTGCGATTCCTCACATGCGCGACTC
CAGCTTCGCACCGTCACCGAACCCTCTGGCTCTGAGCAAGCCCCTGTCGCAGACGCAGCCGCCTACAGCAACGTC
GCCATTACCGGCGTGAGCTCGCAGGCGGCTACCGTCAGCTCTGCGTCAGACACCGTCGCCAGCTCGGCCTCGGAC
ACGGTCGTCAGCTCTGCCTTGGACACTGTCGCCAGCTCTGGTCTGGACACGGCCACTAGCAACGTCAATACCGCC
CCCTCGGCCAGTACTAATACCGTCACGGCCGCCACGTCCTCTTACACCAGCGCCTCTTTCGCAGCTCCAACTAGC
CTTCTGGCAGACATCAAGACGACGTCGTGGCTCACAACTGCCCCGGCGTCCACTCCTTCACCCATCACCTCCACA
CATGCCATCTTCAGCGATCTACGTAATGGAACTAATGGTGAGTATACTCGCTGAAGCCTCGGCCTTTGTTGCCGT
GGGACTGACGGTCTCTCATCAGCTATGCCTAATGCAAACTCGTCGCTCGCTACCTCTCCTCTCACCGTCTCTTCG
TCTCCCTCCAACTCGTCGCTGCCGTCGTCTCTGAACTCTTCGTCACCCACCACCTCCTCTTTTGATGTGTCCATA
CTGTCGGCACCGACGTCTTTCACCCGGACGTCTACCGAGTCGCAGGTTACTTCGTTGGTACGCGAAGTCGTGACG
AAAACGGACCTTGAAAGCGAGTCGACGGAGTCTGCAGACGCACAGAGCACCTCTTTTGTCACCGAATTCTTCGAC
GACTCATCGTCTTCTCTTCCGGCGACAGCTAGTACGAGCTCAGGTGGAGGCGCCGTCGCTCCTGAAACTACCGGG
AGCATTCCACCAAACAAAGGCTCGGGAACCAGGTCCAACGCTGCGGCGCCCCCGGAAGCGCTGCCCCCAAAGGCG
CGCGTCATTGTCGGCGTCGTTACCAGCGTCGCTGGCGTCGCATTCATCATGCTTCTCGCGCTTCTGGCTCTCAAA
TACAACAAGAAGCGCAGGGATGGCCGCCAGTTACTCGGAGGTGGTCACCTGGGCTCGATGACACCCAGGGGTATT
ACGGGCAGCGACTCGATGACGACGGTCGAAGTGCCGGGCCTGCCGACGACCCCCGCCCCCCCCACCGGATTTGGG
GGCAGCAGGGGTGACGCGCCAGCGGAGCGGGGCTTCTACCGAGTGGCTGGTCGGAAGCTACCGCCGGTCCTGATG
ACGGGCGGTGACGGCTTCTCGGACCCCCGGGATACCATGCTGAGCGACAACTCCTCCGAGGCTCTGGACCCGGCG
GCAGGCGGCTCACGTCCGTTGGCCCTCGGTGCGCCAATGAGGCCCGTCAGTGGGATTCCTATTATGCGCTCTGGA
CCGGCCCGTACGCCCGTCACGCAGAATCCATTTGCCGATCCCCCATCTTCGCCGTTAGCGCAGGGTGGCCCGCCG
GGATCGCGGGATCGATCCAGGTTTCACGAAGGGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail