Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7714
Gene name
Locationscaffold_78:18434..19305
Strand-
Gene length (bp)871
Transcript length (bp)690
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04573 SPC22 Signal peptidase subunit 4.5E-39 1 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12133|SPC3_YEAST Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 1 188 4.0E-19
sp|Q6CRY8|SCP3_KLULA Microsomal signal peptidase subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPC3 PE=3 SV=1 62 186 7.0E-15
sp|Q6BPD6|SPC3_DEBHA Microsomal signal peptidase subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC3 PE=3 SV=2 1 198 1.0E-14
sp|Q6C4R5|SPC3_YARLI Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 1 184 2.0E-14
sp|Q9MA96|SPC3A_ARATH Signal peptidase complex subunit 3A OS=Arabidopsis thaliana GN=At3g05230 PE=2 SV=1 1 184 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12133|SPC3_YEAST Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 1 188 4.0E-19
sp|Q6CRY8|SCP3_KLULA Microsomal signal peptidase subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPC3 PE=3 SV=1 62 186 7.0E-15
sp|Q6BPD6|SPC3_DEBHA Microsomal signal peptidase subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC3 PE=3 SV=2 1 198 1.0E-14
sp|Q6C4R5|SPC3_YARLI Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 1 184 2.0E-14
sp|Q9MA96|SPC3A_ARATH Signal peptidase complex subunit 3A OS=Arabidopsis thaliana GN=At3g05230 PE=2 SV=1 1 184 5.0E-14
sp|Q60MW2|SPCS3_CAEBR Probable signal peptidase complex subunit 3 OS=Caenorhabditis briggsae GN=CBG22979 PE=3 SV=1 1 186 1.0E-13
sp|Q9VCA9|SPCS3_DROME Signal peptidase complex subunit 3 OS=Drosophila melanogaster GN=Spase22-23 PE=2 SV=1 1 186 7.0E-13
sp|Q53YF3|SPC3B_ARATH Signal peptidase complex subunit 3B OS=Arabidopsis thaliana GN=At5g27430 PE=2 SV=1 1 184 1.0E-12
sp|P28687|SPCS3_CHICK Signal peptidase complex subunit 3 OS=Gallus gallus GN=SPC22 PE=1 SV=1 1 186 5.0E-12
sp|Q10259|SPC3_SCHPO Probable microsomal signal peptidase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc3 PE=3 SV=1 14 188 2.0E-11
sp|P61009|SPCS3_HUMAN Signal peptidase complex subunit 3 OS=Homo sapiens GN=SPCS3 PE=1 SV=1 1 186 2.0E-10
sp|P61008|SPCS3_CANLF Signal peptidase complex subunit 3 OS=Canis lupus familiaris GN=SPCS3 PE=1 SV=1 1 186 2.0E-10
sp|Q3SZU5|SPCS3_BOVIN Signal peptidase complex subunit 3 OS=Bos taurus GN=SPCS3 PE=2 SV=1 1 186 2.0E-10
sp|P34525|SPCS3_CAEEL Probable signal peptidase complex subunit 3 OS=Caenorhabditis elegans GN=K12H4.4 PE=1 SV=1 1 186 7.0E-10
sp|Q9D365|SPCS3_MOUSE Signal peptidase complex subunit 3 OS=Mus musculus GN=Spcs3 PE=1 SV=1 1 186 1.0E-09
sp|Q568Z4|SPCS3_RAT Signal peptidase complex subunit 3 OS=Rattus norvegicus GN=Spcs3 PE=2 SV=1 1 186 3.0E-09
sp|B0G180|SPCS3_DICDI Signal peptidase complex subunit 3 OS=Dictyostelium discoideum GN=spcs3 PE=3 SV=1 54 187 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005787 signal peptidase complex Yes
GO:0006465 signal peptide processing Yes
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0031224 intrinsic component of membrane No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0006518 peptide metabolic process No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0098796 membrane protein complex No
GO:1905368 peptidase complex No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0016485 protein processing No
GO:0051604 protein maturation No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7714
MHSSFTRIQNAFGFFTTAACVFAAFIAATDLFASRTPSGTITPQNLQVVKGRPHYYSSKKEEYAIIRFSLSADLS
SLFTWNTKQVFVYITADWPDVPGQNVSNSAVIWDSIITNPSADHLQNIGPIAMKKLKRSAQGKTIDPSRGILQLK
NQKPKYQIGHPSGKIAEGRDVTLKLHYNVQPWVGLLTWNMDMDIGLWKRVSGGLSKAFNLPAIKSKDSKSKSKSK
SKSN
Coding >Ophio5|7714
ATGCACTCATCGTTTACGCGGATCCAGAACGCCTTTGGCTTCTTTACAACAGCCGCCTGCGTCTTCGCCGCCTTC
ATCGCCGCGACGGACCTTTTCGCCTCGCGGACGCCGTCCGGAACCATCACGCCCCAGAACCTCCAGGTCGTCAAG
GGTCGTCCGCATTATTACAGCTCTAAGAAGGAAGAGTACGCCATCATCCGCTTCTCCCTCTCCGCCGACCTCTCC
TCTCTGTTCACCTGGAACACGAAACAAGTCTTCGTCTACATCACCGCCGACTGGCCCGATGTTCCCGGTCAGAAT
GTCTCCAACTCAGCTGTCATCTGGGACTCCATCATTACGAATCCGAGCGCCGACCACCTTCAGAACATTGGCCCC
ATTGCAATGAAGAAGCTTAAGAGGAGTGCGCAAGGAAAGACCATCGACCCTAGCAGGGGCATCCTCCAACTCAAG
AACCAAAAGCCAAAGTACCAAATCGGTCACCCCTCCGGCAAGATCGCCGAGGGTCGAGACGTCACGCTCAAGCTG
CATTACAACGTCCAGCCCTGGGTCGGCCTCCTGACATGGAACATGGACATGGATATAGGCTTGTGGAAGAGGGTG
AGCGGTGGGCTGAGCAAAGCCTTCAACCTCCCCGCCATAAAGTCCAAAGATAGCAAGAGCAAGAGCAAGAGCAAG
AGCAAGAGCAAC
Transcript >Ophio5|7714
ATGCACTCATCGTTTACGCGGATCCAGAACGCCTTTGGCTTCTTTACAACAGCCGCCTGCGTCTTCGCCGCCTTC
ATCGCCGCGACGGACCTTTTCGCCTCGCGGACGCCGTCCGGAACCATCACGCCCCAGAACCTCCAGGTCGTCAAG
GGTCGTCCGCATTATTACAGCTCTAAGAAGGAAGAGTACGCCATCATCCGCTTCTCCCTCTCCGCCGACCTCTCC
TCTCTGTTCACCTGGAACACGAAACAAGTCTTCGTCTACATCACCGCCGACTGGCCCGATGTTCCCGGTCAGAAT
GTCTCCAACTCAGCTGTCATCTGGGACTCCATCATTACGAATCCGAGCGCCGACCACCTTCAGAACATTGGCCCC
ATTGCAATGAAGAAGCTTAAGAGGAGTGCGCAAGGAAAGACCATCGACCCTAGCAGGGGCATCCTCCAACTCAAG
AACCAAAAGCCAAAGTACCAAATCGGTCACCCCTCCGGCAAGATCGCCGAGGGTCGAGACGTCACGCTCAAGCTG
CATTACAACGTCCAGCCCTGGGTCGGCCTCCTGACATGGAACATGGACATGGATATAGGCTTGTGGAAGAGGGTG
AGCGGTGGGCTGAGCAAAGCCTTCAACCTCCCCGCCATAAAGTCCAAAGATAGCAAGAGCAAGAGCAAGAGCAAG
AGCAAGAGCAACTAG
Gene >Ophio5|7714
ATGCACTCATCGTTTACGCGGATCCAGAACGCCTTTGGCTTCTTTACAACAGCCGCCTGCGTCTTCGCCGCCTTC
ATCGCCGCGACGGACCTTTTCGCCTCGCGGACGCCGTCCGGAACCATCACGCCCCAGAACCTCCAGGTGTAAGAA
AGAGCTGGCTGCATTCCTACCGCCCCTTTCACCACTTCCGGGCATTGAGCCCGGAAAAAAAGGCGTTGCTGCTGA
CCTTTTCTTCCTCTCTCTTCCACATGCAGCGTCAAGGGTCGTCCGCATTATTACAGCTCTAAGAAGGAAGAGTAC
GCCATCATCCGCTTCTCCCTCTCCGCCGACCTCTCCTCTCTGTTCACCTGGAACACGAAACAAGTCTTCGTCTAC
ATCACCGCCGACTGGCCCGATGTTCCCGGTCAGAATGTCTCCAACTCAGCTGTCATCTGGGACTCCATCATTACG
AATCCGAGCGCCGACCACCTTCAGAACATTGGCCCCATTGCAATGAAGAAGCTTAAGAGGAGTGCGCAAGGAAAG
ACCATCGACCCTAGCAGGTTCGCTTAAACCCCCTCCGGGTGTCACTGATATACCAACATTGGCTAAACCCGCCTT
TCCTCGTAACAGGGGCATCCTCCAACTCAAGAACCAAAAGCCAAAGTACCAAATCGGTCACCCCTCCGGCAAGAT
CGCCGAGGGTCGAGACGTCACGCTCAAGCTGCATTACAACGTCCAGCCCTGGGTCGGCCTCCTGACATGGAACAT
GGACATGGATATAGGCTTGTGGAAGAGGGTGAGCGGTGGGCTGAGCAAAGCCTTCAACCTCCCCGCCATAAAGTC
CAAAGATAGCAAGAGCAAGAGCAAGAGCAAGAGCAAGAGCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail